KEGG   Sinorhizobium fredii HH103: SFHH103_02882Help
Entry
SFHH103_02882     CDS       T01731                                 

Definition
putative lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SFHH103_02882
Enzymes [BR:sfh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SFHH103_02882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3113361..3114344
Genome map
AA seq 327 aa AA seqDB search
MTTILHSTPDNPIPGKPQVGFFDGAGGRKIRYAVFKANAPVTRGTIVLLQGRNESIEKYF
ETIGDLASAGFWVATFDWRGQGGSERLLPQPGHGHVEHFADYERDLTIFLEQIVLPDTRL
PFSIVAHSMGALVALSLAPMLASRIDRMVLLAPFLGLSGQAVGERGIVAIATVMRWFGLG
NLPVRRDKERPTPFASNPLTTDSRRYQRNLALIDARPHLRIGPPTGRWLSESFRVIRRAM
RREHLTKIIVPTVILAPTADALVPYLAMEFLASNFRAGHLIPIDGARHELLQEADRYRAQ
ALAAILAFLPEADGEEADLSPRTMEDA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatccttcattccacgccggacaatccgatacccggcaagccccaagtgggc
tttttcgacggcgccggcggccgcaagatccgctatgcggtgttcaaggcgaacgcgccg
gtgacacgcggcacgatcgtgctcttgcagggacgcaacgagtcgatcgagaaatacttc
gaaacgatcggcgacctcgcgtcagcgggattttgggtcgccactttcgactggcgcggc
cagggtgggtccgagcggcttttgccgcagccaggtcacggccacgtggagcattttgcc
gactacgaacgcgacctcacgatattcctcgagcagatcgtcctgcccgacacgcgcctg
cccttctccatcgtcgctcattcaatgggcgcattggtcgccctgtcgctggcgccgatg
ctggcaagccgcatcgaccgcatggtgctgcttgcccccttcctgggcctgagcggccag
gcggtcggcgagcgcggcatcgtggcgatcgccaccgtcatgcgctggttcggcctcggc
aacctgccggtgcgccgcgacaaggaacgcccgacgccgttcgcgagcaatccgctgacc
accgacagtcgacgctatcagcgcaacctggccttgatcgacgcccgtccgcatttgcgg
atcgggccgccgacgggccggtggctcagcgagtcgttcagagtgatcaggcgcgcgatg
cgccgcgagcacctgacgaagatcatcgtcccgaccgtcatcctggcgccgacggccgac
gctctcgtgccctatctcgcgatggaatttctcgccagcaatttccgggccggccacctg
atcccgatcgatggggcgcgccatgaactcctccaggaagccgaccgctaccgcgctcag
gcgctcgccgcgatcctggcttttcttccggaagccgacggcgaggaggccgacctttcg
ccgcgcaccatggaagacgcgtaa

DBGET integrated database retrieval system