KEGG   Sinorhizobium fredii HH103: SFHH103_02902Help
Entry
SFHH103_02902     CDS       T01731                                 

Gene name
glgB
Definition
protein GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SFHH103_02902 (glgB)
Enzymes [BR:sfh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SFHH103_02902 (glgB)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFHH103_02902 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3141346..3143556
Genome map
AA seq 736 aa AA seqDB search
MTSPPGKNETPAASGFLPAQEIEAILSGTHSDPFAVLGVHASGKSYVARCFVPGAATVVA
ETLSGNDVGALERRHDAGFFEGPVALRKAQPVRYRARNPGGEWVVVDPYSFGPVLGPMDD
YYIREGSHLRLFDRLGAHPIAHDGAEGFHFAVWAPNARRVSVVGNFNDWDGRRHVMRLRA
DTGIWEIFIPGVPIGAPYKYEILGNDGTLLPLKADPFARRSELRPDTASVTTGEIAQVWD
DEAHRRHWDEVDPRRQPISIYEVHASSWQRRDNGDMLSWDELAGRLIPYCVDMGFTHIEF
LPISEFPYDPSWGYQTTGLYSPTARFGEPEGFARFVNGCHKAGIGVILDWVPAHFPTDEH
GLRWFDGTALYEHEDPRQGFHPDWNTAIYNFGREEVAAYLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRQHGEWVPNEYGGNENLEAVRFLQTMNSRLYGIHQGVLTIAEESTSWPKV
SHPVHTGGLGFGFKWNMGFMHDTLQYLSREPVHRKFHHNDMTFGLIYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYAFMWGYPGKKLLFMGQEFAQWREWSEERQLDW
NLLEYNLHEGMRRLVRDLNGTYRAKPALHARDCEGEGFEWLIADDRDNSVFAWLRKAPGE
KLVAVVTNFTPVYREDYDVPLPVAGRWKEILNTDAEIYGGSGKGNGGAVQAEKRSNGRTM
ATITLPPLATLMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaccgcccggcaagaacgaaacgcccgctgcgtcaggctttctgccggcgcag
gaaatcgaggcaatactttccggcacccacagcgatccctttgccgttctcggcgttcac
gcatccggcaagagctatgtcgcgcgctgcttcgtccccggcgcggcgacggtggtcgcg
gaaaccctgtccggcaacgacgtcggagcacttgagcggcgccacgacgcggggtttttc
gaaggtcccgtcgcgctccgcaaggcgcagccggtccgctaccgggcccgcaatccgggc
ggcgaatgggtcgtggtcgatccatacagtttcggtcccgtccttgggccgatggacgac
tactacatccgcgaaggctcgcatctcaggctcttcgacaggctgggggcccacccgatc
gcgcatgacggtgccgaaggctttcacttcgccgtctgggcgccgaacgcgcgccgcgtt
tcggtcgtcggcaacttcaacgactgggacgggcgtcgccacgtcatgcggctgcgcgcc
gacacgggcatctgggaaatcttcatccccggcgtgccgattggcgccccttacaaatac
gagattctcggcaacgacggcacgctgctgcctctgaaggccgatccgttcgcccggcgc
tcggagctccgccccgacaccgcatcggtaaccacgggcgaaatcgcccaggtctgggac
gacgaggcgcaccggcggcactgggatgaagtcgatccgcgccggcagccgatttccatc
tatgaggtccatgccagctcgtggcagcgccgcgacaatggcgatatgctctcctgggac
gaactggcgggacgcttgatcccctattgcgtcgacatgggctttacccatatcgaattc
ctgccgatttccgaatttccctacgacccgtcatggggttaccagaccaccggcctttac
tcgccgaccgcgcgcttcggcgagccggagggctttgcccgcttcgtcaatggctgccac
aaggccggcatcggcgtcattctcgactgggtgccggcgcattttccgaccgacgagcat
ggcttgcgctggtttgacggcacggcgctctacgagcacgaggatccacgccagggcttc
catcccgattggaacacggcaatctacaatttcggccgtgaggaggtcgccgcctatctc
gtcaacaacgccctctattgggccgagaagttccatgtcgacggcctgcgcgtcgatgcg
gtcgcgtcgatgctctatctcgactattcgcgccagcatggcgaatgggtgccgaacgaa
tatggcggcaatgaaaatctcgaggcggtgcgcttcctgcagacgatgaacagccgcctc
tacggcatccatcagggcgtcctgacgatcgccgaggagtcgacctcctggccgaaggtc
tcgcatccggttcacaccggcgggctcggcttcggcttcaaatggaacatgggcttcatg
cacgacacgctgcaatatctgtcgcgcgagccggtgcaccgcaagttccaccacaacgac
atgaccttcgggctcatctacgccttcagcgagaacttcgtcctgccgctgtcgcatgac
gaggtcgtgcacggcaagggatcgctgatcgccaagatggccggcgacgattggcagaag
ttcgccaatctcagggcctactacgccttcatgtggggttatcccggcaagaagctgctg
ttcatggggcaggagttcgcccaatggcgcgaatggtcggaagagcgccagctcgactgg
aacctgctcgaatacaaccttcacgaaggcatgcgacggctggtccgcgacctgaacggc
acctaccgcgcaaagccggcgctgcatgcgcgcgactgcgagggcgagggcttcgagtgg
ctgatcgccgacgaccgggacaattcggtcttcgcgtggctcagaaaggcgccgggcgag
aaactggtcgcggtcgtcacgaacttcacgcccgtctaccgtgaggattacgacgtgccg
ctgccggtcgccgggcgctggaaggaaatcctcaacaccgatgcggagatctacggggga
agcggcaagggcaacggcggcgccgtgcaggcggaaaagagatcgaacggaaggacgatg
gccaccatcacgctgccgccgctggcgacgctgatgctggagcaggattga

DBGET integrated database retrieval system