KEGG   Sinorhizobium fredii HH103: SFHH103_03109Help
Entry
SFHH103_03109     CDS       T01731                                 

Gene name
rocF
Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SFHH103_03109 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SFHH103_03109 (rocF)
Enzymes [BR:sfh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SFHH103_03109 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3365000..3365923
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVHDEGDLRPLPARDLANH
AGANNLQMVAAFARELNDTVHDTARKGHVPIILGGDHALSMGSVSGMARYAHEVGRPLFV
LWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFTPILAPDRPLVDPKRVYQVGIRSVDA
REREEIAEHGVNVYDMRAVDEIGMAHIMRQILDEVRASNGLLHVSLDVDFMDPEFAPGVG
TTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatcacgttgatcggcgcacccatcgaggaaggttccgggcgccgcggcgcg
gccatgggcccgacggcgctcaggatcgccggcatcgacacggtccttgccgaactgggc
catacggtccacgacgaaggcgacctacgacccctgccggcccgcgaccttgcaaaccat
gcgggcgcgaacaatctgcagatggttgccgcctttgcccgggagctcaacgacacggtg
catgacacggcccgcaagggacatgtcccgatcattctcggcggcgaccacgccctgtcg
atgggcagcgtctccggcatggcgcgctacgcgcacgaagtcggccggccgctcttcgtg
ctctggctcgacgctcatgcggacttcaactcgccttcgacctcgccatccggcaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggaattcaccccgatcctcgccccc
gaccggccgctcgtcgacccgaaaagggtctaccaggtcggcatccgttcggtcgacgca
cgcgagcgcgaggagatcgccgagcacggcgtcaatgtctacgacatgcgggccgtcgac
gagataggcatggcccatatcatgcgtcagatcctcgacgaggtgcgcgcgtccaacggc
ttgctgcatgtgagcctcgacgtcgatttcatggatccggagtttgccccgggcgtcggc
accaccgtgccgggcggcgccaccttccgcgaggctcatctcatcatggagatgctttgc
gacagcggcctcgtctcgtcgctcgacgtcgtcgaactcaacccgttcctcgatgaccgc
ggcaagagcgcccgcatcctggttgagctgacggcgagcctcttcggccgccgcatcctt
gaccgtccgacccggagcgcctga

DBGET integrated database retrieval system