KEGG   Sinorhizobium fredii HH103: SFHH103_03109Help
Entry
SFHH103_03109     CDS       T01731                                 

Gene name
rocF
Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfh01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sfh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3365000..3365923
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVHDEGDLRPLPARDLANH
AGANNLQMVAAFARELNDTVHDTARKGHVPIILGGDHALSMGSVSGMARYAHEVGRPLFV
LWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFTPILAPDRPLVDPKRVYQVGIRSVDA
REREEIAEHGVNVYDMRAVDEIGMAHIMRQILDEVRASNGLLHVSLDVDFMDPEFAPGVG
TTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRSA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatcacgttgatcggcgcacccatcgaggaaggttccgggcgccgcggcgcg
gccatgggcccgacggcgctcaggatcgccggcatcgacacggtccttgccgaactgggc
catacggtccacgacgaaggcgacctacgacccctgccggcccgcgaccttgcaaaccat
gcgggcgcgaacaatctgcagatggttgccgcctttgcccgggagctcaacgacacggtg
catgacacggcccgcaagggacatgtcccgatcattctcggcggcgaccacgccctgtcg
atgggcagcgtctccggcatggcgcgctacgcgcacgaagtcggccggccgctcttcgtg
ctctggctcgacgctcatgcggacttcaactcgccttcgacctcgccatccggcaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggaattcaccccgatcctcgccccc
gaccggccgctcgtcgacccgaaaagggtctaccaggtcggcatccgttcggtcgacgca
cgcgagcgcgaggagatcgccgagcacggcgtcaatgtctacgacatgcgggccgtcgac
gagataggcatggcccatatcatgcgtcagatcctcgacgaggtgcgcgcgtccaacggc
ttgctgcatgtgagcctcgacgtcgatttcatggatccggagtttgccccgggcgtcggc
accaccgtgccgggcggcgccaccttccgcgaggctcatctcatcatggagatgctttgc
gacagcggcctcgtctcgtcgctcgacgtcgtcgaactcaacccgttcctcgatgaccgc
ggcaagagcgcccgcatcctggttgagctgacggcgagcctcttcggccgccgcatcctt
gaccgtccgacccggagcgcctga

DBGET integrated database retrieval system