KEGG   Sinorhizobium fredii HH103: SFHH103_03193Help
Entry
SFHH103_03193     CDS       T01731                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sfh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3454163..3455179
Genome map
AA seq 338 aa AA seqDB search
MSTDTEIFGHLPSGEPVYRVTLEGGGLIAKVLTWGSVIQDLRLEGHAAPLVLGFEDFDSY
PSHSSYFGATPGRNANRIGDGRFTLEGNAYQLEVNEKGVTHLHGGSDNIAKRNWSIVERA
EDRVTLRITDPDGRAGYPGNCTVTCTYTLKPGGTLNVLYETETDAPTLANVCQHSYFNLD
GGEDARGHDIMIAADHYLPTDERLIPTGEIRPVAGTPFDLREMTSLRRQMEGDKIAYDHN
FCLSPERMQKRSVALVRSINSGVSLEVLTTEPGVQLYTGSKLNVPVPGLGGRRYGPFAGF
CLETQIWPDAVNHAGFPKAVLRPGETLRQETDYVFAKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacacggaaatcttcggccacctaccctctggtgaaccggtctatcgggtg
acgcttgagggcggcgggctgatcgccaaggtgttgacctggggctcggtcatccaggac
ctcaggctcgaaggccatgcggccccgctcgtcctcggtttcgaggatttcgacagttat
ccatcccattcctcctatttcggtgccacgcccggccgcaacgccaaccgtatcggcgac
ggtcgcttcacgctcgaaggcaacgcctaccagctcgaggtcaacgaaaagggtgtcacg
catctgcatggcggcagcgacaatatcgccaagcgcaactggtcgatcgtcgagcgggcc
gaggaccgcgtcacgctccggatcaccgaccccgacggccgcgccggctatcccggcaat
tgcacggtcacctgcacctatacgctgaagcccggcggcacgttgaacgtcctctacgaa
accgaaacggatgcgccgacgctcgccaatgtctgtcagcacagctatttcaacctcgac
ggcggcgaggatgcgcgcggccatgacatcatgatcgccgccgaccattacctgccgacg
gacgagcggctgatcccgaccggcgaaatccgcccggttgccggcacccctttcgatctc
cgcgaaatgacctcgctcaggcgccagatggagggcgacaagatcgcctacgaccacaat
ttctgcctctcgcccgagcgcatgcagaagcgctcggtggcgctggtgcgcagcatcaat
tccggcgtgtcgctggaggtgctgacgacggagcccggcgtccagctctataccggcagc
aagctgaacgtcccggtcccgggcctcgggggccgtcgctacggccccttcgccggcttc
tgcctcgaaacgcagatttggcccgacgcggtgaaccacgcaggttttccgaaggcggtg
ctgaggcccggcgagacgctccggcaggagacggattacgtttttgcgaagaactga

DBGET integrated database retrieval system