KEGG   Sinorhizobium fredii HH103: SFHH103_03200Help
Entry
SFHH103_03200     CDS       T01731                                 

Gene name
proB
Definition
protein ProB
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SFHH103_03200 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SFHH103_03200 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SFHH103_03200 (proB)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SFHH103_03200 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3461855..3463036
Genome map
AA seq 393 aa AA seqDB search
MAATRRPLEKYRRIVIKIGSALLVDRKSGLKKSWLDAMCADIAALKAKGVEVLVVSSGAI
ALGRTVLNLPAGALKLEESQAAAAVGQIALARAWSESLSTDQIIAGQILLTLGDTEERRR
YLNARATINQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPEARFLESIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPEHPLKAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLTIDAGAETALRSGKS
LLPAGVRQVSGTFSRGDTIAILNHSGREIARGLAGYDADDARQIAGKKSAEIAAILGYAG
RTAMVHRDDMVMTAPSGARSEEGGNEKRGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacccgcagaccgctcgaaaaataccgtcggatcgtcatcaagatcggctcg
gcgctcctcgtcgaccgcaagagcgggctgaagaagagctggctcgacgccatgtgcgcc
gatatcgccgcgctgaaggcgaagggcgtcgaggtgctggtcgtctcctcgggtgccatc
gcgctcggccgcaccgtgctgaacctgccggccggcgccctaaagctcgaggaaagccag
gcggcggccgccgtcggccagatcgccctggcgcgcgcctggtcggaaagcctttcgacc
gatcagatcatcgccgggcagatcctgttgacgctcggcgatacggaggagcgccgccgc
tacttgaatgcgcgcgccacgatcaaccagttgctgaagctcggctccgtgccgatcatc
aacgagaacgacacggtcgccaccaccgagatccgctacggcgacaacgaccggctagcc
gcccgggtcgcgacgatggtcggcgccgacctgctcgtcctgctgtccgatatcgacggc
ctctatacggctccgccgcatctcgatccggaggcccgcttcctcgagtcgattgccgag
atcaccccggagatcgaggcgatggcaggcggcgcggcctccgagctgtcgcgcggcggc
atgcgcaccaagatcgatgccggcaagatcgccaccaccgccggctgcgcgatgatcatc
gcctccgggaagccggagcacccgctgaaggcgatcgaggccggcgcccgctcctcctgg
ttcgcgccttccggttcgccggtgacggcccgcaagacctggatcgccgggcagctcctg
ccggccggttcgttgacgatcgacgccggggcggagacggcactgcgttccggcaagagc
ctgctgccggccggtgtccggcaggtgtcgggaacgttcagccgcggcgacaccattgcg
atccttaaccattccggccgcgagatcgcccgcggccttgccggctatgacgccgacgac
gcgcgccagatcgccggcaagaaatcggccgagatcgctgcgatcctcggctatgccggc
cgcaccgccatggtgcaccgcgacgatatggtcatgacggctccctccggcgcgcggtcc
gaggagggagggaatgagaagaggggcaagctccatgcttga

DBGET integrated database retrieval system