KEGG   Sinorhizobium fredii HH103: SFHH103_03222Help
Entry
SFHH103_03222     CDS       T01731                                 

Definition
phosphodiesterase/alkaline phosphatase D,PhoD-like
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sfh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sfh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3484580..3486139
Genome map
AA seq 519 aa AA seqDB search
MADIRSTLTRRSFLFSAGGAGLMASSGLATPFYARGYGRPEFLHGVQSGDVDPQSGMIWT
RVDRPARVAVEYSTTESFSNAVRLADIDVTPQTDCAVKCSLDNLLPDQDIFYRFTATDLY
DANRVSEPIVGRFRTAPLRRRSVRFVWSGDTAGQGWGIDEVGMKTYSTMRQHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTPEKRDVARTLEEYRGQWKYNLLDEHVRGLNAV
CPTFYQWDDHEVLNNWSASTDLRDDSRYPEKDVAVYASRAARAFHEMTPIRTLPTQPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQGGEAGLFGWRQADWLKRELAASRATWKVIACDMPV
GLVVWDDYSKKRGADAIANGDNGAPQGRETEFADLLRFIRDNAIDNIVWLTADVHYTAAH
HYDPSRAAFKDFLPFWEFVSGPLHSGTYGPKELDMTFGPEVRFIKASGGGIDSNLPPSAG
LQFFGIVDISGQTRQMTVRLMDRQDKELWRVTLDPAAVV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttggctgacattcgaagcacgctcaccaggcgttccttcctcttctccgccggcggcgcc
ggtctcatggcttcttccggccttgcgacacctttctatgcgcgcggctacggtcggccg
gaattcctgcacggggtgcagtccggcgatgtcgatccgcaatcggggatgatctggacg
cgcgtggatcgtccggcccgcgttgcggtcgaatattcgaccaccgagagtttctcgaac
gccgtccggcttgccgacatcgacgtgacgccgcagaccgattgcgcggtcaaatgcagc
ctcgacaacctgctgccggaccaggacatcttctaccgcttcaccgcgaccgatctttac
gacgccaatcgcgtctcggagccgatcgtcgggcgttttcgcaccgcgcccttgcgccgc
cggtcggtgcgcttcgtctggtccggcgacacggccggccagggctggggcatcgacgag
gtcggcatgaaaacctattcgaccatgcgccagcacgagccggacttcttcattcactcc
ggcgacacgatctatgccgacaatccgatccccgacgagatcaagcttcgtgacggcggc
atgtggaagaaccggatcgtgacgccggaaaagcgcgacgtcgcccgcacgctcgaggaa
tatcgcggccagtggaaatacaatctcctcgatgagcatgtgcggggcttgaacgccgtc
tgcccgaccttctatcaatgggacgatcatgaagtcttgaacaactggtcggcctccacc
gaccttcgcgacgattcgcgctatccggagaaggacgtggcggtctacgcatcccgtgcg
gcgcgtgccttccacgagatgacgccgatccgcacgctgccgacccagccggggcggatc
ttccgcaagatcgcctatggaccgctgctcgacgtgttcttcgtcgacctgcgttcctat
cgcggcccgaaccagggcggcgaggccgggctcttcggctggcggcaggcggactggctg
aaacgcgaactcgccgcctcgcgcgccacctggaaggtgatcgcctgcgacatgccggtc
ggcctcgtcgtctgggacgattattcgaagaagcgcggagcggacgcgatcgccaatggc
gacaatggcgctccacagggccgcgagacggaatttgccgatctcctgcgcttcatccgc
gacaatgcgatcgacaacatcgtctggctgacggcggacgtgcactatacggccgcgcat
cactacgacccgtcgcgcgccgccttcaaggatttcctgcccttctgggaattcgtctcc
ggtccgctgcattccgggacctatggcccgaaggaactcgatatgaccttcggcccggag
gtgcgtttcatcaaggcgtcgggcggcggcatcgacagcaacctgccgccctcggcgggg
ctgcaattcttcggtatcgtcgatatcagcggccagacgcggcagatgaccgtgcggctc
atggaccggcaggacaaggagctttggcgggtgacgctcgatccggcagcggtcgtttga

DBGET integrated database retrieval system