KEGG   Sinorhizobium fredii HH103: SFHH103_03527Help
Entry
SFHH103_03527     CDS       T01731                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SFHH103_03527 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SFHH103_03527 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SFHH103_03527 (trpB)
Enzymes [BR:sfh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SFHH103_03527 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3832195..3833415
Genome map
AA seq 406 aa AA seqDB search
MNQPLKPNSFRAGPDEDGRFGIFGGRFVAETLMPLILDLQDEWNKAKNDPVFKAELENLG
AHYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGHGTLKD
AMNEALRDWVTNVDNTYYLIGTAAGPHPYPEMVRDFQAVIGQEAKEQLLAAEGRLPDLVV
AAVGGGSNAIGIFHPFLDDDGVRIVGVEAGGKGLDGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagccgctaaagccgaactccttcagggccggaccggacgaggacggccgtttc
ggtattttcggcggccgtttcgtcgccgagaccctgatgccgctgatcctcgatctccag
gacgaatggaacaaggcaaagaatgatccggtcttcaaggccgagctcgaaaatctcggt
gcccattacatcggccggccgagcccgctctatttcgccgagcgcctgacggccgagctc
ggcggcgcgaagatctatttcaagcgcgaggagctgaaccataccggctcgcacaagatc
aacaattgcatcggccagatcctgctcgccaagcgcatgggcaagacccgcatcatcgcc
gagaccggtgccggccagcacggcgtggcttcggcaaccgtcgccgcccgcttcgggctt
ccctgcgtggtctacatgggcgccaccgacgtcgagcgccaggcgccgaacgtcttccgc
atgaagcttctgggcgccgaggtgaagccggtgacggccggtcacggcacgctgaaggac
gccatgaacgaggcgctgcgcgactgggtgacgaatgtcgacaacacctattatctgatc
ggcacggccgccggcccgcatccctatccggagatggtccgtgacttccaggcggtcatc
ggccaggaggccaaggaacagcttctcgcggccgaaggccgcttgcccgacctcgtcgtt
gcggcggtcggcggcggctccaacgcgatcggcatcttccatcccttcctggacgacgac
ggcgtcaggatcgtcggtgtcgaagcgggtggcaaggggctcgatggggacgagcactgt
gcctcgatcaccgccggctcgccgggcgtgctgcacggcaaccgcacctacctgctccag
gatggcgacggccagatcaaggaaggccattccatctcggccggtctcgattatccgggt
atcggtccggaacatgcctggctcaacgatatcggccgggtcgaatatgtgccgatcatg
gaccatgaggcgctcgaagccttccagaccctgacgcggcttgaaggcatcatcccggcg
ctggagccgtcgcatgcgctggccgaggtcatcaagcgggcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtcggcaaa
attctgggaatggggcagtaa

DBGET integrated database retrieval system