KEGG   Sinorhizobium fredii HH103: SFHH103_03528Help
Entry
SFHH103_03528     CDS       T01731                                 

Gene name
trpA
Definition
(GenBank) trpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SFHH103_03528 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SFHH103_03528 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SFHH103_03528 (trpA)
Enzymes [BR:sfh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SFHH103_03528 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3833421..3834260
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSFSIMRALPKAGADVIELGVPFSDPMA
DGPAIQLAGQRALRAGQTLAKTLELARRFRAEDQRTPIVLMGYYNPIYIYGVERFLDDAV
EAGVDGLIVVDLPPEMDDELCIPALKKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPLLIAGAVARIKSHTKLPVCVGFGVKTAEHARAIGASADGVVVGTAIVNQ
IASSLTEEGRVTEATVPGVEALVRGLSAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaaaggttcgccgacgttgcggcagagggccgtccggtgctt
gtcacctatttcatgggcggcgatcccgattttgacacgtcgttttcgatcatgcgggcg
ctgccgaaggcgggcgccgacgtgatcgagctcggcgtgcccttttccgatccgatggcc
gacggtccggcgatccagcttgccggccagcgcgcgctgagggccgggcagacgctcgcc
aagacgctcgagctcgcccgccgcttccgggccgaggaccagcgcaccccgatcgtgctg
atgggctattacaacccgatctatatctacggcgtcgagcggttcttggacgatgctgtc
gaggcgggcgtcgacgggttgatcgtcgtcgatctgccgccggaaatggatgacgagctg
tgcatcccggcgctcaagaagggcatcagcttcatccgtctggcaacgccgacgacggac
gaccgccgtctgcccaaggttctcgagaacacctccggattcgtctattacgtctcgatg
accggcatcaccggctccgctctgccggatccgttgctgatcgccggcgcggtggcgcgg
atcaagtcgcatacgaaactgcctgtctgtgtcggtttcggggtcaagaccgccgaacat
gcgcgggcgatcggcgcctcggccgacggtgtcgtggtggggacggcgatcgtcaaccag
atcgcctcgagcctgacggaagagggccgcgtcaccgaggcgacggtccccggcgtcgag
gcgctggttcggggcctttcggccggggtgcgggcggcacgtcttgcggcagccgaataa

DBGET integrated database retrieval system