KEGG   Sinorhizobium fredii HH103: SFHH103_03559Help
Entry
SFHH103_03559     CDS       T01731                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_03559 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFHH103_03559 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    SFHH103_03559 (glcB)
Enzymes [BR:sfh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SFHH103_03559 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3871687..3873861
Genome map
AA seq 724 aa AA seqDB search
MDRVEKHDLKIDAGLHRFLVDEAMPGTGVDPDRFFAALSHLVHELAPKNRALLARRDELQ
AKLDAWYREHGAPVDLDAYQAFLKEIDYLLPEGPDFSVSTANVDAEIATIAGPQLVVPVM
NARYSLNAANARWGSLYDALYGTDAIPDADGATRGRSYNPARGAKVIAWARDFLDASVPL
AEGRWSEVGGLAIAGGALSLILTSGARTALRNPAQFVGYSGSAEAPSEIVLSQNNLHVVI
VLDATTPIGEADAAGISDIILESAITTIMDCEDSVAAVDAEDKIVVYRNWLGLMKGDLEE
EVAKGGRTFTRKLNADRAFTGPDGETLSLPGRSLMLVRNVGHLMTNPAILDRDGREIPEG
LLDAMVTALIALHDIGPSGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIRTSMEAGPMIRKGDMK
QAAWIGAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAEIQAGLKSRPRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MADVVDQQNADDPSYAPMAGRFDESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAN
QRAS
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaacatgatctgaagatcgatgcgggccttcaccgcttcctggtc
gatgaggcgatgccgggtaccggcgtcgacccggaccgtttttttgcggccctctcgcac
ctcgttcacgaactcgcgccgaagaaccgcgcccttctcgccaggcgcgacgagctccag
gctaagctcgatgcctggtatcgcgagcatggcgccccggtcgacctcgacgcctaccag
gctttcctgaaggaaatcgactatctcctgccggaaggaccggatttttccgtgtcgacc
gccaatgtcgatgccgagatcgccaccattgccggcccacagctggtcgtgccggtgatg
aatgcccgctattcgctgaacgccgccaatgcgcgctggggttcgctctatgatgcgctc
tacggcaccgacgcaattcccgatgcggatggggcgacgcgcggcagaagctacaatccg
gcgcgcggtgccaaggtcatcgcctgggcgagggactttctcgacgccagcgttccgctc
gccgagggccgttggagcgaggtcggtgggctggcgatcgctggcggtgctctctcactg
atcttgacgagcggtgccaggacggcacttcgcaatccggctcagttcgtcggctattcc
ggctcggccgaggcgccttcggaaatcgtcctcagccagaacaaccttcacgtcgtgatc
gtcctcgatgcaacgacgccgatcggtgaggccgatgccgccggcatttccgacatcatc
ctcgaatcggcgatcaccacgatcatggactgcgaggattccgttgctgcggtcgatgcc
gaggacaagatcgtcgtctatcgcaactggctggggctgatgaagggcgacctcgaggaa
gaggtcgccaagggcggcaggacgttcacgcgaaagctgaacgccgaccgcgccttcacc
gggcctgatggcgaaacgctgagcttgcccggccgctcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaacccggcgatcctcgaccgcgacgggcgcgagatccccgaaggc
ctgttggacgccatggtgacggcgctgattgcgctgcacgacatcggcccgagcggccgg
cgggcaaattcgcgcagcggctcgatgtatgtggtcaagccgaagatgcatggtcccgag
gaagtggccttcgcctgcgagatcttcgcgcgggtcgaggcggcgctcgggctgccggcc
aatacgatcaagatgggcatcatggacgaggaacggcgcaccaccgtcaacctcaaggaa
tgcatccgcgccgcccgtgagcgggtcgtcttcatcaatacgggcttcctcgaccgcacc
ggcgacgagatccgcacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcggcctggatcggcgcctacgaaaactggaacgtcgatatcggcctcgaatgcgga
ctttccggccacgcccagatcggcaagggcatgtgggccatgccggacctgatggccgcg
atgctggagcagaagatcgcccacccgaaggccggtgccaacaccgcttgggttccctcg
ccgacggcggcgacgctgcatgcgacgcactaccaccgggtcaacgtcgccgagatacag
gcgggtctcaaaagccggccgcgcgccaagctcgccgatattctctcggtgcccgtcgcg
gcccggccgaactggacggaagaagaaatccagcgcgaactcgacaacaacgcccagggg
atcctcggctatgtcgtgcgctgggtcgaccagggcgtcggctgctccaaggtgcccgac
atcaacaatgtcgggctgatggaagaccgcgcgacgctgcgcatctctgcgcagcacatg
gccaactggctgcaccacggcatagtcagcgaggcgcagatcgtcgagacgatgaagcgg
atggcggacgtcgtcgaccaacagaatgccgatgacccgagctacgcgccgatggccggc
cgttttgacgaatcgatcgccttccaggcggcactcgatctggtcctcaaggggcgcgaa
cagccaaacggctataccgaaccggtgctgcatcgccgccgtttggagttgaaggcgaac
caacgggcgtcgtga

DBGET integrated database retrieval system