KEGG   Sinorhizobium fredii HH103: SFHH103_03559Help
Entry
SFHH103_03559     CDS       T01731                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sfh01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sfh00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sfh00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3871687..3873861
Genome map
AA seq 724 aa AA seqDB search
MDRVEKHDLKIDAGLHRFLVDEAMPGTGVDPDRFFAALSHLVHELAPKNRALLARRDELQ
AKLDAWYREHGAPVDLDAYQAFLKEIDYLLPEGPDFSVSTANVDAEIATIAGPQLVVPVM
NARYSLNAANARWGSLYDALYGTDAIPDADGATRGRSYNPARGAKVIAWARDFLDASVPL
AEGRWSEVGGLAIAGGALSLILTSGARTALRNPAQFVGYSGSAEAPSEIVLSQNNLHVVI
VLDATTPIGEADAAGISDIILESAITTIMDCEDSVAAVDAEDKIVVYRNWLGLMKGDLEE
EVAKGGRTFTRKLNADRAFTGPDGETLSLPGRSLMLVRNVGHLMTNPAILDRDGREIPEG
LLDAMVTALIALHDIGPSGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NTIKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIRTSMEAGPMIRKGDMK
QAAWIGAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVNVAEIQAGLKSRPRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMKR
MADVVDQQNADDPSYAPMAGRFDESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAN
QRAS
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaacatgatctgaagatcgatgcgggccttcaccgcttcctggtc
gatgaggcgatgccgggtaccggcgtcgacccggaccgtttttttgcggccctctcgcac
ctcgttcacgaactcgcgccgaagaaccgcgcccttctcgccaggcgcgacgagctccag
gctaagctcgatgcctggtatcgcgagcatggcgccccggtcgacctcgacgcctaccag
gctttcctgaaggaaatcgactatctcctgccggaaggaccggatttttccgtgtcgacc
gccaatgtcgatgccgagatcgccaccattgccggcccacagctggtcgtgccggtgatg
aatgcccgctattcgctgaacgccgccaatgcgcgctggggttcgctctatgatgcgctc
tacggcaccgacgcaattcccgatgcggatggggcgacgcgcggcagaagctacaatccg
gcgcgcggtgccaaggtcatcgcctgggcgagggactttctcgacgccagcgttccgctc
gccgagggccgttggagcgaggtcggtgggctggcgatcgctggcggtgctctctcactg
atcttgacgagcggtgccaggacggcacttcgcaatccggctcagttcgtcggctattcc
ggctcggccgaggcgccttcggaaatcgtcctcagccagaacaaccttcacgtcgtgatc
gtcctcgatgcaacgacgccgatcggtgaggccgatgccgccggcatttccgacatcatc
ctcgaatcggcgatcaccacgatcatggactgcgaggattccgttgctgcggtcgatgcc
gaggacaagatcgtcgtctatcgcaactggctggggctgatgaagggcgacctcgaggaa
gaggtcgccaagggcggcaggacgttcacgcgaaagctgaacgccgaccgcgccttcacc
gggcctgatggcgaaacgctgagcttgcccggccgctcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaacccggcgatcctcgaccgcgacgggcgcgagatccccgaaggc
ctgttggacgccatggtgacggcgctgattgcgctgcacgacatcggcccgagcggccgg
cgggcaaattcgcgcagcggctcgatgtatgtggtcaagccgaagatgcatggtcccgag
gaagtggccttcgcctgcgagatcttcgcgcgggtcgaggcggcgctcgggctgccggcc
aatacgatcaagatgggcatcatggacgaggaacggcgcaccaccgtcaacctcaaggaa
tgcatccgcgccgcccgtgagcgggtcgtcttcatcaatacgggcttcctcgaccgcacc
ggcgacgagatccgcacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcggcctggatcggcgcctacgaaaactggaacgtcgatatcggcctcgaatgcgga
ctttccggccacgcccagatcggcaagggcatgtgggccatgccggacctgatggccgcg
atgctggagcagaagatcgcccacccgaaggccggtgccaacaccgcttgggttccctcg
ccgacggcggcgacgctgcatgcgacgcactaccaccgggtcaacgtcgccgagatacag
gcgggtctcaaaagccggccgcgcgccaagctcgccgatattctctcggtgcccgtcgcg
gcccggccgaactggacggaagaagaaatccagcgcgaactcgacaacaacgcccagggg
atcctcggctatgtcgtgcgctgggtcgaccagggcgtcggctgctccaaggtgcccgac
atcaacaatgtcgggctgatggaagaccgcgcgacgctgcgcatctctgcgcagcacatg
gccaactggctgcaccacggcatagtcagcgaggcgcagatcgtcgagacgatgaagcgg
atggcggacgtcgtcgaccaacagaatgccgatgacccgagctacgcgccgatggccggc
cgttttgacgaatcgatcgccttccaggcggcactcgatctggtcctcaaggggcgcgaa
cagccaaacggctataccgaaccggtgctgcatcgccgccgtttggagttgaaggcgaac
caacgggcgtcgtga

DBGET integrated database retrieval system