KEGG   Sinorhizobium fredii HH103: SFHH103_03628Help
Entry
SFHH103_03628     CDS       T01731                                 

Gene name
deoA
Definition
protein DeoA
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SFHH103_03628 (deoA)
Enzymes [BR:sfh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SFHH103_03628 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3954580..3955890
Genome map
AA seq 436 aa AA seqDB search
MLPQEVIRKKRNGGRLEVAEIAAFIEGITDASISEGQVAAFAMAVWFTGMSRDECVALTL
AMRDSGETLDWSALGRPIVDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTGGT
LDKLESIPGYNIQPSPALFHKVIDEVGCAIIGQTANLAPADKRLYAIRDVTATVDSVPLI
TASILSKKLAAGLQSLVLDVKLGNGSFLTDPSETEILARSLVDVANGAGVRTSALITDMN
EPLADAAGNVLEIENCLAYLRGEKAGTRLDRVVMAFAAEMLVAAGVVADEVQAEALARNA
LASGAALERFGRMVHLLGGPADFVDRPDAYLDKAPVVLPVPANRDGYLSACETRELGMAI
IALGGGRTRPDESIDHRVGLADLRPLGTQVQEGEPIAFVHAADRQRAEMVRGRVAALYAI
ADERPVPRPVVVSRIT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctcccacaggaagtgatccggaagaagagaaacggcggccggctcgaggtggcggag
atcgccgctttcatcgaaggcataaccgacgcttcgatctcggaagggcaggttgccgcc
ttcgccatggccgtttggttcacgggcatgagccgcgacgaatgcgtggcgctgacgctg
gcgatgcgcgattccggcgaaacgctcgactggagcgcgctcgggcggccaatcgtcgac
aagcattcgaccggcggtgtcggcgacaatgtctcgctgatgctggcaccgatcgtggcc
gcctgcggcgccgccgtgccgatgatctcgggccgggggctcggccataccggcggcacg
ctcgacaagctcgagtccattccgggttacaatatccagccctccccagcgctctttcat
aaggtgatcgacgaggtcggttgcgccatcatcggccagaccgccaatctggcgccggcc
gacaagcgcctctatgcgatccgcgacgtgacggcgacggtcgattcagtgccgctgatc
accgcgtcgatcctctcgaagaagctcgcggccgggcttcagtcgctggtgctggacgtc
aagctcggcaacgggtccttcctgaccgatccctcggaaaccgaaatcctcgcgcgatca
ctcgtcgacgtcgccaacggggcgggggtgcgcacctcggcgctgatcaccgacatgaac
gaaccgctggcggacgcggccggcaacgtgctcgaaatcgagaactgtcttgcctatctg
cgcggcgagaaggcggggacgcggctcgatcgggtggtgatggccttcgcggcggaaatg
ctcgtcgcagcgggcgtggtggcggacgaggtgcaagccgaggcgctggcacgcaacgct
cttgcgagcggtgccgcgttggagcgcttcggccgcatggtgcatctgcttggtggaccg
gcggatttcgtcgaccggccggatgcttatctcgacaaggcgccggtcgtgctgcctgtg
cctgccaatcgcgacggctatctgagcgcctgcgagacccgcgaactggggatggccatc
attgcgctcggtggcgggcgtacccgcccggatgagagcatcgaccatcgcgtcggactc
gcggacctgaggccactcggaacgcaagtgcaagagggcgaaccaatcgctttcgtgcat
gccgccgatcggcagcgggccgaaatggtaagaggcagggtcgcggcgctctatgcgatc
gccgacgagcggcctgtgccacgccccgtcgtcgtttcaagaatcacctga

DBGET integrated database retrieval system