KEGG   Sinorhizobium fredii HH103: SFHH103_03658Help
Entry
SFHH103_03658     CDS       T01731                                 

Gene name
glk
Definition
glucokinase (glucose kinase) protein, Glk
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_03658 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_03658 (glk)
   00052 Galactose metabolism
    SFHH103_03658 (glk)
   00500 Starch and sucrose metabolism
    SFHH103_03658 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SFHH103_03658 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SFHH103_03658 (glk)
   00524 Butirosin and neomycin biosynthesis
    SFHH103_03658 (glk)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SFHH103_03658 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3984292..3985311
Genome map
AA seq 339 aa AA seqDB search
MPSASDHSFSFPILIGDIGGTNARFALLVDAASEPTPLPPIKTGDFATIEEALQKSIFDR
ISERPRSAILAVAGPIKSDEIPLTNAGWVIRPKDMLARLGLEDVLVINDFEAQALAIAAP
ADQDVAPIGGGSVRPRSSRVVLGPGTGLGVAGLVFAQDTWIPVPGEGGHVDIGPRSERDF
QVWPFLDPIEGRMAGEQILCGRGIMNLYRAVCAADGLEPSLKDQAEVTTNALSGDDPAAV
ETVSLFSTYLGRVAGDMALVFMARGGVFLAGGISQKILPALMKPEFRAAFENKAPHSALM
RTIPTFAVVHPMAALSGLAAFARAPRDFGVAMEGRRWRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtgcgagtgaccacagcttctcctttccgatcttgatcggcgatatcggcggt
acgaatgcccgtttcgcattgctcgtcgatgcggcttccgagccgacgccgttgccgcca
atcaagacgggtgacttcgcgaccatcgaggaagcgctgcagaagagcattttcgacagg
atctccgagaggccgcgttcggcgatccttgccgtggcagggccgatcaagagcgacgag
atcccgctgaccaatgccggctgggtgatccggccgaaggacatgctggcgaggctcgga
ctggaagacgtgctggtcatcaacgacttcgaggcgcaggcactcgccattgccgcgccg
gccgatcaggacgtcgcgccgatcggcggcggcagcgtccggccgcgcagttcccgcgtg
gtgctcggccccggcaccgggctcggcgtcgccggtctcgtctttgcccaggacacctgg
attcctgtgccgggcgaaggcggtcatgtcgacatcggaccccgaagcgaacgcgatttt
caagtctggccgttcctcgaccccatcgaaggccgcatggcgggcgagcagatcctgtgc
ggacgcggcatcatgaatctctaccgcgccgtctgcgcggccgatggcctggagccgtcg
ctcaaggatcaggcggaggtgacgaccaacgctctctcaggcgacgatccggccgccgtc
gagacggtgtcgctgttctctacctatctgggacgcgttgccggcgacatggcgctggtc
ttcatggcgcgcggcggtgtcttcctggctggcggcatttcgcagaagatactgccggca
ctgatgaaaccggaattccgcgccgccttcgagaacaaggcaccgcactcggcgctgatg
cggacgattccgactttcgcggtcgttcatcccatggcggcgctttccgggcttgccgcc
ttcgcacgcgccccgagggatttcggtgttgcaatggagggacggcgctggagaagctga

DBGET integrated database retrieval system