KEGG   Sinorhizobium fredii HH103: SFHH103_03768Help
Entry
SFHH103_03768     CDS       T01731                                 

Gene name
phob3
Definition
alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SFHH103_03768 (phob3)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SFHH103_03768 (phob3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SFHH103_03768 (phob3)
Enzymes [BR:sfh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SFHH103_03768 (phob3)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFHH103_03768 (phob3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4105507..4107264)
Genome map
AA seq 585 aa AA seqDB search
MRKFLSALAAATMLAGVADAATVYPLDRATILVGSPFDFKVEFDGVVKQEDVKVTINGQD
AKSVLGADVEFVADEQDKDGKSLGSAVTLRAAKVAKAGAYKVEVSAGDQAKTVTWDVFGT
SATPKAKNVIFLLADGLSVSHRTGARLMSKGMTEGKANGRLFMDDLDHMAFIGTSATNAI
ATDSANTMSAYMTGHKTAINALGVYADRTPDSLDDPRVENIAEAVRRLTKKSIGVVSTAE
IEDATPAAVIAHTRKRGDKADIATMFLDTKPDVILGGGSAYFLSKDVAGSKRKNDKDLIK
AFEDDGYTLATDKSELASAAGTNSGKILGLFHTGNMDVALDREFLKKGTVEKFPNQPGLK
DMTKVALEQLSKNPEGFFLMVEGASVDKMSHPMDWDRSLIETIEFDQVVGMAREFAKAHP
DTLIVVTGDHTHGVSIIGTIDDEKPGTEMREKVGVYADAGFPNYEDKDGDGFPDKVDVSR
RLAMFANNYPDYYETFRPKMDGPFEPAIENEKKEYVANPAYKDVPGAVLREGNLPRNADT
AVHAVDDVVLQAAGPGAGEFKGYMEESDVYRVLADVFALGSSENM
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatttctatccgctctcgccgccgccaccatgctggctggcgttgctgacgca
gccaccgtctacccgctcgatcgtgcgacgatcctcgtcggctcgcctttcgacttcaag
gtcgagttcgacggcgtcgtcaagcaggaagacgtgaaggtcaccatcaatggccaggac
gccaagtccgttctcggcgccgatgtcgaattcgtggccgatgaacaggacaaggatggc
aagagcctcggttccgccgtgaccttgcgcgccgccaaggtcgccaaggccggcgcctac
aaggtggaagtcagcgccggcgaccaggcaaagaccgtaacctgggacgtattcggcacc
tcggccacgccgaaggccaagaacgtcatcttcctcctcgccgacggtctgtcggtttcc
catcgcaccggcgcccgcctgatgtcgaaggggatgaccgaaggcaaggcgaacggacgt
cttttcatggatgacctcgaccacatggccttcatcggcacgtccgcgaccaatgcgatc
gccaccgacagcgccaacaccatgtccgcctacatgaccggccacaagacggcgatcaac
gcgctcggcgtctatgccgaccgcaccccggattcgcttgacgacccgcgcgtcgaaaac
atcgccgaagcggtgcgccgcctcaccaagaagtcgatcggcgtcgtttccaccgccgag
atcgaggacgccacgccggccgccgtcatcgcccacacccgcaagcgcggcgacaaggcc
gacatcgccacgatgttcctcgacacgaagccggacgtcatcctcggcggcggttcggcc
tacttcctctccaaggacgtggcgggctcgaagcgcaagaacgacaaggacctgatcaag
gccttcgaggacgacggctatacgctggcgaccgacaagtcggagctcgcctccgccgcc
ggcaccaattccggcaagatcctcggcctgttccacaccggcaacatggacgtggcgctt
gaccgcgaattcctcaagaagggcacggtcgagaagttcccgaaccagcccggcctcaag
gacatgaccaaagtcgctctggaacagctttccaagaatccggaaggcttcttcctgatg
gtggaaggcgcctcggtcgacaagatgtcgcatccgatggattgggaccggtcgctcatc
gaaaccatcgagttcgaccaggtggtcggcatggcccgcgaattcgccaaggcccatcct
gacacgctgatcgtcgtgaccggcgaccacacgcatggcgtttcgatcatcggcacgatc
gacgacgagaagccgggcaccgagatgcgcgagaaagtcggcgtctatgcggatgctggc
ttcccgaactacgaggacaaggacggagacggcttccccgacaaggtcgacgtgagccgc
cggctcgccatgttcgccaacaactatccggactattacgagaccttccgtccgaagatg
gacggtccgttcgagccggccatcgagaacgagaagaaagaatacgtcgccaatccggcc
tacaaggacgtgcccggcgccgtgctgcgcgaaggcaacctgccgcgcaatgccgatacc
gccgttcacgcagttgatgacgtcgtgctgcaggccgccggtccgggcgccggggagttc
aagggctatatggaagagagcgacgtctaccgcgtcctcgccgacgtctttgcgctcggc
agcagcgagaacatgtaa

DBGET integrated database retrieval system