KEGG   Sinorhizobium fredii HH103: SFHH103_03794Help
Entry
SFHH103_03794     CDS       T01731                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SFHH103_03794 (recR)
DNA repair and recombination proteins [BR:sfh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SFHH103_03794 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4132887..4133492
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQSVIIVVEDVADLWALERAAALNAAYHVLGGTLSPLDGI
GPDDLNIKGLVDRVAKGGVRELVIAVNATVEGQTTAHYITDQLEGMEVKITRLAHGVPVG
GELDYLDEGTLTAALRARTTI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtcccgaaatcgaaaagctcatccagctcctggcgaaggtg
ccgggcctcggcccccgttccgcccggcgcgcggcgctgcatctcgtcaagaagaaggag
caattgctcggtcctcttgccgaggcgatgggcgaggcgcaccgcaaggtcaagatctgc
tcctgctgcggcaatgtcgacacgatcgatccctgcaccgtctgcaccgacgagcggcgc
gaccagtcggtgatcatcgtcgtcgaggacgttgccgatctctgggcgctggaacgcgcc
gcggcgctgaacgccgcctatcatgtgctcggcggcacgctgtcgccgctcgacggcatc
gggccggacgacttgaacatcaaggggctggtcgaccgcgtcgccaagggcggcgtgcgc
gagctggtcatcgccgtcaacgcgaccgtcgagggccagacgacggcccattacatcacc
gaccagctcgaaggcatggaggtgaagatcacccgtctcgcccatggcgttccggtcggc
ggcgagctcgattatctcgacgaaggcacgctgacggcggcgcttagggcgcgcaccacg
atctga

DBGET integrated database retrieval system