KEGG   Sinorhizobium fredii HH103: SFHH103_03966Help
Entry
SFHH103_03966     CDS       T01731                                 

Gene name
mutM
Definition
protein MutM
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sfh03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4302519..4303409
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVKRGLAPTMEGALLVRAELRRPDLRFPFPENFAAAVSGRRILALSRRAKYL
MIDLEGGDVIVAHLGMSGSFRIEAGTQPVAPGGFHHPRGKDEKHDHVIFHLDGGSGQTRV
IYNDPRRFGFMDLARRDTIAEHAFFRDLGEEPTGNALDAVYLAARFAGKSQPLKTALLDQ
RTIAGLGNIYVCEALWRSGLSPNRAAGTLVDKRGRPKRALFALVEAIRAVIADAIAAGGS
SLRDHIQADGSLGYFQHAFSVYDREGEACRKPDCGGTVARIVQAGRSTFHCPRCQK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcctgaggtcgagacggtcaaacgcggattggcgccgacgatggagggg
gcgcttttggtgcgtgccgaattgcgccggccggacctgcgctttccctttcccgagaat
ttcgccgccgctgtttcgggccgccgcatcctggcgttgtcgcggcgggcaaaatatctg
atgatcgacctcgagggcggcgacgtgatcgtcgcgcatctcggcatgtccgggtcgttc
cgcatcgaggccggcacgcagccggtggcgcccggcggattccaccatccgcgcggcaag
gacgagaagcacgaccatgtgatcttccatctcgacggaggctccggccagacgcgggtg
atctacaacgacccgcgccgcttcggcttcatggatctggcgcggcgcgatacgatcgcc
gagcacgccttcttccgcgatctcggcgaggagccgaccggcaatgcgctcgacgccgtc
tacctggccgcccggtttgccggaaaatcgcagccgctgaagacggcgctcctcgaccaa
aggacgatcgccggcctcggcaatatctatgtttgcgaggcgctgtggcgatccggcttg
tcgccgaacagggccgccggaacgctggtcgacaagcgcggtcgtccgaaacgggccttg
ttcgcgcttgtcgaggcgatccgcgcggtgattgccgacgcgatcgctgccggcggctcg
tcgctcagggaccatatccaggcggatggcagcctcggctatttccagcatgccttttcc
gtctacgaccgggagggcgaggcttgccgtaagccggattgcggcggtacggtcgcccgc
atcgttcaggcagggcgttcgaccttccattgcccgcgctgccagaaataa

DBGET integrated database retrieval system