KEGG   Sinorhizobium fredii HH103: SFHH103_03967Help
Entry
SFHH103_03967     CDS       T01731                                 

Definition
(GenBank) predicted enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00071  Fatty acid degradation
sfh00280  Valine, leucine and isoleucine degradation
sfh00281  Geraniol degradation
sfh00310  Lysine degradation
sfh00360  Phenylalanine metabolism
sfh00362  Benzoate degradation
sfh00380  Tryptophan metabolism
sfh00410  beta-Alanine metabolism
sfh00627  Aminobenzoate degradation
sfh00640  Propanoate metabolism
sfh00650  Butanoate metabolism
sfh00903  Limonene and pinene degradation
sfh00930  Caprolactam degradation
sfh01100  Metabolic pathways
sfh01110  Biosynthesis of secondary metabolites
sfh01120  Microbial metabolism in diverse environments
sfh01130  Biosynthesis of antibiotics
sfh01212  Fatty acid metabolism
Module
sfh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFHH103_03967
   00650 Butanoate metabolism
    SFHH103_03967
  Lipid metabolism
   00071 Fatty acid degradation
    SFHH103_03967
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFHH103_03967
   00310 Lysine degradation
    SFHH103_03967
   00360 Phenylalanine metabolism
    SFHH103_03967
   00380 Tryptophan metabolism
    SFHH103_03967
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFHH103_03967
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SFHH103_03967
   00281 Geraniol degradation
    SFHH103_03967
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFHH103_03967
   00627 Aminobenzoate degradation
    SFHH103_03967
   00930 Caprolactam degradation
    SFHH103_03967
Enzymes [BR:sfh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SFHH103_03967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCE98458
UniProt: G9A6E8
Position
4303485..4304258
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETRGRVGLITLNRPQALNALNSTLMRELDAALKAFDVDKGVGAIVITGSEKA
FAAGADIKEMQALDFVDSYLGDFLGGWEHVAGARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDATEAERAGLVARIV
APDKLLEEALAAAEKIASFALPAVMMAKEAVSRSLEVTLAEGLRFERRLFQALFATEDQK
EGMAAFVAKRKAEFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgctgctggtcgagacgcgcgggcgcgtcggcctgatcaccctcaat
cggccgcaggcgctgaatgcgctgaattcgaccctgatgcgcgagcttgatgcagcgttg
aaggccttcgatgtggacaagggtgtcggtgcgatcgtcatcacaggctcggaaaaggca
ttcgcggccggtgccgatatcaaggaaatgcaggcgctcgatttcgtcgacagctacctc
ggtgattttctcggcggttgggagcacgtcgccggcgctcgcaagccgatgatcgcggcg
gtttccggctttgcgcttggcggtggctgtgaactcgccatgatgtgcgacttcatcatc
gcatcggagacggcgaaattcggccagccggaaattactctgggcgtcatccccggcatg
ggcgggtcgcagcgcctgacgcgggcggtcggcaaggcgaaggcgatggacctcatcctg
actggccgcatgatggacgcgaccgaagccgagcgggccggcctcgttgcgcggatcgtc
gcgcccgacaagttgctggaagaggcgcttgccgctgccgagaagatcgcttccttcgcg
cttccggcggtgatgatggcgaaggaggcggtcagccgctcgctggaagtcacccttgcc
gaaggcctgcgtttcgagcggcggctcttccaggcgctgttcgctaccgaagaccagaag
gaggggatggccgccttcgtcgcgaagcgcaaagcggaattcaaacacagatga

DBGET integrated database retrieval system