KEGG   Sinorhizobium fredii HH103: SFHH103_04631Help
Entry
SFHH103_04631     CDS       T01731                                 

Definition
hypothetical protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_04631
   01230 Biosynthesis of amino acids
    SFHH103_04631
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_04631
   00030 Pentose phosphate pathway
    SFHH103_04631
   00051 Fructose and mannose metabolism
    SFHH103_04631
   00052 Galactose metabolism
    SFHH103_04631
  Energy metabolism
   00680 Methane metabolism
    SFHH103_04631
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SFHH103_04631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103d_3:complement(80404..81366)
Genome map
AA seq 320 aa AA seqDB search
MPILAVALNPTIDVWSQAERVRPTVKIRTHSERQRPGGGGVNVARVIAELGGEPELLVLA
GGATGAMLREALATSAIRTHAVQIAGLTRISFMVREEETGLEYRFVPEGPEVAPGDIAKA
LAIVERFRGDFVVASGSLPRNAPEDIYADIGRIAAKTGARFILDCPGATLRSTLGKAPVF
LVKPSIEELETLAGRRLDENGVAQAASALVKETAAEFVAVTMGREGALLAGAFGVLRVPS
KHVVAKSTVGAGDSFIGALTWLLAEGRSIEEAFRFGVAAGAAAVIASGTELCRRNDVFKI
YNGTEPPPGVPSTSIESSGP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccttgcagtggctctcaaccccaccatcgacgtatggagtcaggctgagcgg
gtgcgtccgaccgttaagatccgtacgcacagcgagcggcaacgaccgggcggcggcggc
gtcaatgtcgcacgcgtcatcgccgagctcggcggcgagccggagctcctcgtcctcgcg
ggcggagcgactggagccatgcttagagaggcccttgcgacatcagccattcgaactcac
gccgtgcagatagcagggctgacgcgaatttcctttatggttcgggaagaggaaacgggg
ctcgaatatcgcttcgttcccgaagggccggaagtcgcgccgggcgacatcgcgaaggcg
cttgcgatcgttgagaggttcaggggcgacttcgtggtggccagcgggagtctgccgcgc
aacgctcccgaagacatctatgctgacattggccgcatagccgcgaaaaccggcgccagg
ttcattctcgactgcccgggggcgacattgcgcagcaccttgggcaaggcaccggttttc
ctcgtcaaaccgagcattgaagagttggaaacactggccggccggcgtctggacgagaat
ggggtcgcgcaagccgcatcggctttggtgaaggaaactgcagcagagttcgttgcagtc
actatgggccgcgagggtgccctcttggctggagccttcggcgttttacgcgtcccgtct
aagcacgtcgtcgccaagtccaccgtgggtgccggcgacagcttcattggcgcgctcact
tggttgctggcggaaggcaggtcaattgaggaggcgttccggtttggtgtcgccgcggga
gcagccgccgtcatcgcatccggaaccgagctgtgccggcgcaacgacgtctttaagatt
tacaacgggaccgaaccgcctccaggcgtgccgtcgacgtccatcgaaagctccggtcca
tga

DBGET integrated database retrieval system