KEGG   Sinorhizobium fredii HH103: SFHH103_04663Help
Entry
SFHH103_04663     CDS       T01731                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sfh00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103d_3:120372..121244
Genome map
AA seq 290 aa AA seqDB search
MAVRSGFRGSGGNTTVDEKARKDLVESLLPVVRAAGAAILAHRRTPLPFRFKNDASPVTV
ADLESEAIIRRTCAGLFPAIRLVSEEDASSYEAGIPSTCLLVDPLDGTKEFISGREDFTV
NIALIENGAPSAGIIFAPALDRMFFTSGSGKLVVMDHEDTREILGGVVADQRAQPLILTS
RSHLDPHTAEVVKHLQSTNVRQVGSSLKFALIAAGEADLYLRLAPTMVWDSAAGQALIEA
AGGVVLRPDGIRLPYLAEMKNEGFVAACTISLAERVLMLIRSLRNTGPPD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggtacgatcaggctttcgcggctcgggaggaaatacgacagtggatgagaaggca
agaaaggatctcgttgagagtcttctgccggtggtcagagcggcaggcgcagctatctta
gcgcatcgcaggacgccgctcccattccgcttcaaaaacgacgcctcacccgttactgtt
gcggatcttgagagtgaagcgatcatacggcgaacctgcgcaggcctctttccggccatt
cggctcgtaagtgaagaagacgcgtcgagctatgaagcgggtattccttccacttgcctc
ctcgtcgaccctttggacgggaccaaggaattcatctcaggacgagaggatttcaccgtc
aatatcgctctgatagagaatggggcaccgtctgccggaatcatcttcgcgccggcgctt
gaccgaatgttcttcaccagcggctcggggaagctcgtcgtcatggatcacgaggacacc
cgcgaaattctcggcggtgtggtggccgaccaacgcgcgcagccgctgattctcaccagt
cgttctcaccttgatccgcacacagcagaggttgttaagcacttgcaatcgaccaatgtt
cggcaggtcggttcctcgttgaagttcgctctcatcgccgctggcgaagcagatctctat
ctccggcttgcaccgacgatggtttgggacagcgccgccggacaagcattgatcgaagct
gccggtggcgtcgttctgcgcccggacggcatccggctgccctatctggctgagatgaag
aatgaaggattcgtcgccgcatgcacaatatctctcgctgagagggtcctgatgctcata
cgcagtcttcgcaacacggggccaccggactga

DBGET integrated database retrieval system