KEGG   Sinorhizobium fredii HH103: SFHH103_04663Help
Entry
SFHH103_04663     CDS       T01731                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SFHH103_04663
Enzymes [BR:sfh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SFHH103_04663
Transfer RNA biogenesis [BR:sfh03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SFHH103_04663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103d_3:120372..121244
Genome map
AA seq 290 aa AA seqDB search
MAVRSGFRGSGGNTTVDEKARKDLVESLLPVVRAAGAAILAHRRTPLPFRFKNDASPVTV
ADLESEAIIRRTCAGLFPAIRLVSEEDASSYEAGIPSTCLLVDPLDGTKEFISGREDFTV
NIALIENGAPSAGIIFAPALDRMFFTSGSGKLVVMDHEDTREILGGVVADQRAQPLILTS
RSHLDPHTAEVVKHLQSTNVRQVGSSLKFALIAAGEADLYLRLAPTMVWDSAAGQALIEA
AGGVVLRPDGIRLPYLAEMKNEGFVAACTISLAERVLMLIRSLRNTGPPD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcggtacgatcaggctttcgcggctcgggaggaaatacgacagtggatgagaaggca
agaaaggatctcgttgagagtcttctgccggtggtcagagcggcaggcgcagctatctta
gcgcatcgcaggacgccgctcccattccgcttcaaaaacgacgcctcacccgttactgtt
gcggatcttgagagtgaagcgatcatacggcgaacctgcgcaggcctctttccggccatt
cggctcgtaagtgaagaagacgcgtcgagctatgaagcgggtattccttccacttgcctc
ctcgtcgaccctttggacgggaccaaggaattcatctcaggacgagaggatttcaccgtc
aatatcgctctgatagagaatggggcaccgtctgccggaatcatcttcgcgccggcgctt
gaccgaatgttcttcaccagcggctcggggaagctcgtcgtcatggatcacgaggacacc
cgcgaaattctcggcggtgtggtggccgaccaacgcgcgcagccgctgattctcaccagt
cgttctcaccttgatccgcacacagcagaggttgttaagcacttgcaatcgaccaatgtt
cggcaggtcggttcctcgttgaagttcgctctcatcgccgctggcgaagcagatctctat
ctccggcttgcaccgacgatggtttgggacagcgccgccggacaagcattgatcgaagct
gccggtggcgtcgttctgcgcccggacggcatccggctgccctatctggctgagatgaag
aatgaaggattcgtcgccgcatgcacaatatctctcgctgagagggtcctgatgctcata
cgcagtcttcgcaacacggggccaccggactga

DBGET integrated database retrieval system