KEGG   Sinorhizobium fredii HH103: SFHH103_05291Help
Entry
SFHH103_05291     CDS       T01731                                 

Gene name
asnB
Definition
asparagine synthase, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFHH103_05291 (asnB)
Enzymes [BR:sfh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SFHH103_05291 (asnB)
Peptidases [BR:sfh01002]
 Cysteine Peptidases
  Family C44
   SFHH103_05291 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:469723..471660
Genome map
AA seq 645 aa AA seqDB search
MCGFGGYFGSIRDGRAILESMTAAIAHRGPDEQGIFTAPEAGLGHVRLSIVGLGDGQQPM
SDASGELTIAFNGEIFNYVELREELRAKGRRFRTSSDTEVILHLYDEMGEDCVSLLNGDF
AFAIWDARRRRIILARDRMGVRPLFYTAQGGTFYFASEVKALLEVPGISAEIDPIALDQI
FTLWAPIAPRTPFRNILELEPAHLMVVDQRGVTTRPYWQLQYPDRDQPSGDVDERNAAEE
LRALLTDATRIRMRADVPVGAYLSGGLDSSIVSALAAGMTPQGLRTFSVTFDSAEHDESA
FQQEMAAALGTQHSAIACRTGDIAKVFPDVIRFTERPIIRTAPAPLFQLSGLVREAGLKV
VLTGEGADEVFAGYDIFKEARVRRFCGRQPGSRIRPHLFRKLYPYLPGLKQQSPEYLAAF
FGAGDAPLDDPLFSHRPRLKGTAATKLFFSGDLRAELKDYDAAAELIGRLPQDFRRWHPL
HQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFPFLDHRLVEFAAKLPPEMKLKGLTEK
HILREATKDLLPPAIGRRVKQPYRAPDSHSFSGPGEFDYVRSALSEDAVAAGGLFNAKAV
TKLHEKCRSRPASGFRDNAAFVGILSTQLWLQTFAGTRIRKAEAA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggttttggcggctattttggctcgatacgggacggaagggcgattctcgaaagc
atgacggccgcgattgcgcatcgggggccggacgaacagggcattttcaccgcgcccgag
gccgggcttggccatgtgcggctctccattgtcgggctcggcgacggccagcagccgatg
tcggatgcgagcggcgaactgacgatcgccttcaacggcgaaatcttcaactatgtcgaa
ctccgggaggagcttcgcgccaagggccgccgcttccgcacgtcgagcgacaccgaggtc
atcctccacctctatgacgagatgggcgaagactgcgtttcgctgctcaacggcgatttc
gccttcgcgatctgggatgcccgccgccgccggatcatactggcgcgcgaccggatgggg
gtgcgcccgcttttctataccgcgcagggcggcaccttctatttcgcctccgaggtcaag
gcgctccttgaggtgccgggcatctcggcggagatcgacccgatcgcgctcgaccagatc
ttcacgctctgggcgccgatcgcgccccgcacacccttccgcaacatccttgagctcgag
ccggcccacctaatggtcgtcgatcagcgtggcgtcacgacgaggccttactggcagctt
caatacccggaccgggatcagccatccggcgacgtggacgaacgaaatgctgccgaggaa
ctgcgcgctctcttgacggatgcgacccgcattcgcatgcgggccgacgtaccggtcggc
gcctatctgtccggcggcctcgattcctcgatcgtctcggcgctggcggccggcatgacg
cctcaggggttgcggaccttctcggtcaccttcgacagcgccgaacatgacgaaagcgcc
ttccagcaggaaatggccgcagcactcggcacgcagcatagcgccatcgcctgccgcacc
ggcgatatcgccaaggtttttccggacgtcatccgcttcaccgagaggccgatcatccgc
acggcaccggcgccgctctttcaattgtccgggctggtgcgggaggccgggctcaaggtc
gtgctgaccggcgagggcgccgacgaggtcttcgcgggctacgatatcttcaaggaagcc
cgggtgcgccgtttttgcggacggcaacccggctcgcgcatccggccgcacctcttccgc
aagctctatccctatctgccgggtctcaagcagcagtcgccggaatatcttgccgccttc
ttcggtgccggcgacgcgccgctcgacgacccgctcttctcgcatcggccgcgcctcaag
ggcacggccgcgacgaagctgttcttttccggcgacctgcgcgctgaactgaaggactac
gatgccgctgcggagctcatcggccggctcccgcaggatttccgccgatggcacccgttg
caccaggcgcaatatctcgaaagccgtttccttttgcccggctatatcctctccagccag
ggcgaccgcatggcgatggcccacggcatcgagggtcgcttccccttcctcgaccaccgg
ctggtcgagtttgccgccaagctgccgccggagatgaagctcaaggggctgacggagaag
cacatcctgcgcgaggcaacgaaggatcttctgccgcctgccatcggcaggcgggtgaag
cagccctatcgtgctcccgacagtcactccttcagcgggcctggcgagttcgattacgtc
cgcagcgccttgagcgaggatgcggtcgccgcgggcggcctcttcaatgccaaggcggtg
acgaagctccacgaaaaatgccgctcgcgcccggcctcgggcttccgcgacaacgccgcc
ttcgtcggcattctctcgacgcagctctggctgcagacatttgcaggcacgcgcatccgc
aaggcggaagcggcctga

DBGET integrated database retrieval system