KEGG   Sinorhizobium fredii HH103: SFHH103_05373Help
Entry
SFHH103_05373     CDS       T01731                                 

Gene name
exoN
Definition
(GenBank) ExoN
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
sfh00040  Pentose and glucuronate interconversions
sfh00052  Galactose metabolism
sfh00500  Starch and sucrose metabolism
sfh00520  Amino sugar and nucleotide sugar metabolism
sfh01100  Metabolic pathways
sfh01130  Biosynthesis of antibiotics
Module
sfh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SFHH103_05373 (exoN)
   00052 Galactose metabolism
    SFHH103_05373 (exoN)
   00500 Starch and sucrose metabolism
    SFHH103_05373 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    SFHH103_05373 (exoN)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SFHH103_05373 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CCE99838
UniProt: G9AFK6
Position
pSfHH103e:complement(554695..555600)
Genome map
AA seq 301 aa AA seqDB search
MDRIRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDTPELISSLSRSGKNAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSYGARGCMAGLMDLYREVGGNVVAVEQCAPEEASKYGIVGKG
DTVRHGFSVTQMVEKPPAGQAPSNFYLNGRYILQPEIFSILAHQARGAGNEIQLTDGMLN
LSADQPFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVRAIVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcatcaggaccgtcaggaaagcagtgatcccggtcgcaggaaacggaacgagg
ttcctccctgcgacaaaggccgtgccgaaggaaatgttgacgatcgtcgatcggcccgtc
gtccaatacgcggtcgatgaggcacgtcaggccggcatcgagcacatcgtcttcgtcacc
agccgcaacaagcaggtgatcgaggaccatttcgacgacacgcccgaactcatctcgtcg
ctgtcgcgctccggtaagaatgcgcagatctccgagctcgaggccatgttgccggccgcc
ggctcggtcagcttcacgcgccagcaggcgccgctcggcctcggccacgcggtgtggtgc
gcgcgcgacctgatcggcgacgagcccttcgcgctgctgctgccggacatggtctcctat
ggcgcacgcggctgcatggccgggctcatggacctctaccgcgaggtcggcggcaatgtt
gtcgcggtcgagcaatgcgcccccgaggaggcttcgaaatacggtatcgtcggcaagggc
gacacggttcggcacggcttctcggtgacgcagatggtcgagaagccgccggcgggccag
gcgccatccaacttttatctaaacggccgctatatcctgcagccggagatcttttccatt
ctcgcgcaccaggcacgcggtgccggcaacgagatccagctgaccgacggcatgctgaac
ctttcggccgaccagcccttccatgcccatccctatgaaggccgtaccttcgattgcggc
tcgaagcagggcttcatcgaggccaatgtcgcctttgcgctcgcccgcgcggatatcggc
gacatcgtgttcgaatcggttcgcgcgatcgtcctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system