KEGG   Sinorhizobium fredii HH103: SFHH103_05477Help
Entry
SFHH103_05477     CDS       T01731                                 

Gene name
tpiA
Definition
hypothetical protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFHH103_05477 (tpiA)
   01230 Biosynthesis of amino acids
    SFHH103_05477 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_05477 (tpiA)
   00051 Fructose and mannose metabolism
    SFHH103_05477 (tpiA)
   00562 Inositol phosphate metabolism
    SFHH103_05477 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SFHH103_05477 (tpiA)
Enzymes [BR:sfh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SFHH103_05477 (tpiA)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SFHH103_05477 (tpiA)
  Exosomal proteins of bladder cancer cells
   SFHH103_05477 (tpiA)
  Exosomal proteins of melanoma cells
   SFHH103_05477 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:660462..661229
Genome map
AA seq 255 aa AA seqDB search
MSKSRLWVGTSWKMNKTLAEAMAFAEGLAAADEERDPRIQRFVIPPFTAVREVKERLKAT
SVKVGAQNMHWEDAGAWTGEISPLMLKDCGLDLVELGHSERREHFGETDRTVGLKTAAAV
RHGLVPLICIGETLAEREAGEADAVLKRQVEGAFALLDGAAKQAPILLAYEPVWAIGVNG
IPATADYADARHRRIAEVAEASLGVAVPVLYGGSVNPANCEELIAQPHIDGLFIGRSAWE
VAGYLDILQRVAGAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcgcggctctgggtcggcaccagctggaagatgaacaagacgctcgcggag
gcgatggccttcgccgaggggctggctgctgccgatgaggagcgtgatccacgcatccag
cgtttcgtcattccgccgttcacggcggtccgcgaggtgaaggagaggctgaaggcgacg
agcgtcaaggttggtgcgcagaacatgcattgggaggatgccggtgcctggaccggcgag
atttcgcccttgatgctgaaggattgcggactcgatcttgtcgagctcggtcacagcgag
cggcgcgaacatttcggcgagacggaccgcaccgtcggtctcaagacggcggccgccgtc
aggcacggtctcgttccgctgatctgcatcggcgaaacgctcgccgaacgagaggcgggc
gaggccgatgcggtcttgaagcgtcaggtggaaggggcgttcgcgctcctcgatggcgcc
gcgaaacaggcgccgatcctgctcgcctacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgattacgccgacgcccgccacaggcggatcgccgaggtggccgag
gcgtcgctcggcgttgccgtgccggtgctctacggcggcagcgtcaatcccgcaaactgc
gaggaactgatcgcccagccccatatcgacggcctcttcatcggccgctccgcttgggag
gtcgccggctatctcgacattctgcagcgtgtcgccggcgcgatctga

DBGET integrated database retrieval system