KEGG   Sinorhizobium fredii HH103: SFHH103_05477Help
Entry
SFHH103_05477     CDS       T01731                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
sfh  Sinorhizobium fredii HH103
Brite
Enzymes [BR:sfh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     SFHH103_05477 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pSfHH103e:660462..661229
Genome map
AA seq 255 aa AA seqDB search
MSKSRLWVGTSWKMNKTLAEAMAFAEGLAAADEERDPRIQRFVIPPFTAVREVKERLKAT
SVKVGAQNMHWEDAGAWTGEISPLMLKDCGLDLVELGHSERREHFGETDRTVGLKTAAAV
RHGLVPLICIGETLAEREAGEADAVLKRQVEGAFALLDGAAKQAPILLAYEPVWAIGVNG
IPATADYADARHRRIAEVAEASLGVAVPVLYGGSVNPANCEELIAQPHIDGLFIGRSAWE
VAGYLDILQRVAGAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcgcggctctgggtcggcaccagctggaagatgaacaagacgctcgcggag
gcgatggccttcgccgaggggctggctgctgccgatgaggagcgtgatccacgcatccag
cgtttcgtcattccgccgttcacggcggtccgcgaggtgaaggagaggctgaaggcgacg
agcgtcaaggttggtgcgcagaacatgcattgggaggatgccggtgcctggaccggcgag
atttcgcccttgatgctgaaggattgcggactcgatcttgtcgagctcggtcacagcgag
cggcgcgaacatttcggcgagacggaccgcaccgtcggtctcaagacggcggccgccgtc
aggcacggtctcgttccgctgatctgcatcggcgaaacgctcgccgaacgagaggcgggc
gaggccgatgcggtcttgaagcgtcaggtggaaggggcgttcgcgctcctcgatggcgcc
gcgaaacaggcgccgatcctgctcgcctacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgattacgccgacgcccgccacaggcggatcgccgaggtggccgag
gcgtcgctcggcgttgccgtgccggtgctctacggcggcagcgtcaatcccgcaaactgc
gaggaactgatcgcccagccccatatcgacggcctcttcatcggccgctccgcttgggag
gtcgccggctatctcgacattctgcagcgtgtcgccggcgcgatctga

DBGET integrated database retrieval system