KEGG   Sinorhizobium fredii HH103: SFHH103_05652Help
Entry
SFHH103_05652     CDS       T01731                                 

Gene name
manB
Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFHH103_05652 (manB)
   00030 Pentose phosphate pathway
    SFHH103_05652 (manB)
   00051 Fructose and mannose metabolism
    SFHH103_05652 (manB)
   00052 Galactose metabolism
    SFHH103_05652 (manB)
   00500 Starch and sucrose metabolism
    SFHH103_05652 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    SFHH103_05652 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    SFHH103_05652 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SFHH103_05652 (manB)
Enzymes [BR:sfh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SFHH103_05652 (manB)
    5.4.2.8  phosphomannomutase
     SFHH103_05652 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(850012..851568)
Genome map
AA seq 518 aa AA seqDB search
MVQVDFARFKPGSAYEPVPESGPDRFTLETSALIRPTGFREYDARWWFGRPDGGKAPELN
LMGVQALGMGLGTFMRRSGAGPEIVTGHDFRSYSLGIKLALVSGLLAAGARVRDIGLALS
PMAYFAQFALDVPSVAMVTASHNENGWTGVKMGTARPLTFGPDEMAELKRIVLEADFDLT
GGGAYEFVPDFRQRYIDDLTHGKRIARKLKVVVACGNGTAGAFAPQVLERIGCEVIPLDC
ELDHSFPRYNPNPEDLVMLHAIRDKVLESGADVGLGFDGDGDRCGVVDNEGREIFADKIG
VMLARDLSALHPDSVFVVDVKSTGLFAADPVLKANGARTDYWKTGHSYIKRRVAELGALA
GFEKSGHFFFNPPLGRGYDDGLITALAVCEMLDRNPGMSMAQLYRALPVTWGSPTMSPHC
DDEVKYAVVERVVERFRTMQRDGLPVAGQKIANLVTVNGVRVVVEDGTWGLVRASSNKPE
LVVVVESPVSEARQRAMFEAVDRVLREHAEVGAYNQTI
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggtggattttgctcgatttaagccaggctcggcctatgagccggtccccgaa
tccggacccgaccggtttacccttgaaacgagcgcgctgataaggccgacagggtttcgg
gagtatgacgcgcgatggtggttcggccggccggatggcgggaaggcaccggaactgaac
ctgatgggggtgcaggctctgggcatgggtctcggcaccttcatgcggcgctcgggtgcc
ggcccggaaatcgtaacaggacatgatttccgttcctattcgctgggcatcaagctcgcc
ttggtcagtggactgttggccgcgggcgcgcgggtccgggacatcggcctggcactgtcg
ccgatggcctatttcgcacagttcgcgctcgacgtgccgtcggtggcgatggtgaccgct
tcgcacaacgagaacggctggaccggcgtcaaaatgggcacggcccggccgttgacgttt
ggaccggacgaaatggctgaactaaaaaggatagtgctggaggccgacttcgacctgacc
ggtggcggagcctatgaattcgtaccggacttccgtcagcgctatatcgacgacctaacc
cacggcaagcgcatcgcccggaagctgaaggttgtggtggcctgcggaaacggcacggct
ggcgcattcgcacctcaggtgctggagcggatcggctgtgaggtgatcccgctcgactgt
gaactcgaccattccttcccacgctacaatcccaatcccgaggacctggtgatgctccac
gccatccgggacaaagtgctggaaagcggcgccgatgtcgggttgggtttcgacggcgac
ggcgaccgctgcggggtggtcgacaacgaaggccgcgagatcttcgccgacaagatcggg
gtgatgctggcacgggatctttccgcactgcatcccgattcggtgttcgtcgtcgacgtg
aagtcgaccggtctgttcgcggctgatccggtgctgaaggcaaatggcgcccgcacggac
tactggaagacgggccattcctatatcaagcgcagggtcgcggaactcggggccctcgcg
ggcttcgaaaagtcggggcactttttcttcaatccgcctctcgggcgcggctatgacgac
gggctgatcactgcgctcgcggtctgcgagatgctcgaccgcaatccaggcatgagcatg
gcccagctctaccgggcgctgccggtgacctggggctcgccgaccatgtcgccgcattgc
gacgatgaagtgaaatatgccgtggtcgagcgcgtggtggagcggttcaggacgatgcag
cgtgatgggctgccggtcgcgggccagaagatagccaacctcgtcaccgtcaacggcgtg
cgcgtggtggtcgaggacggcacttgggggctggtgcgggcctcctccaacaagccggag
cttgtcgtcgtggtggaaagcccggtctcggaagcgcgccaacgcgccatgttcgaggcg
gtcgaccgcgtgctcagggagcatgcggaggtcggtgcctacaaccagaccatctag

DBGET integrated database retrieval system