KEGG   Sinorhizobium fredii HH103: SFHH103_05730Help
Entry
SFHH103_05730     CDS       T01731                                 

Definition
putative beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sfh00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sfh00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(944944..946863)
Genome map
AA seq 639 aa AA seqDB search
MQPVSYRLESAWQPDGGPFGRFTFTLFNLSGRPLGGFRLVYTSLTRVIDPAACGNAVFLR
RNANFHEFAPPEGLTLQPGESWTFLVSGLHRQAKHCTDGAKSAYLTLSDGRHVPVAVSDL
RLEGATSEPPPQRLPEGKLALSFALQPWPAEIDAVPGAEVPVVLYPASGSNTEEIDAVSN
VLALFHRLFPAGHAPFSLAASGQGLPIVFEEKGELGGEAYRLAFSGRDIRLEYGAVSGRQ
YGLTTLVQLLDSARNHPGKFRFPASGTISDRPRYGWRGCHLDVSRQFYPTADVLRLIDIL
AWFKLNIFHWHLTDDEAWRLEIKAYPTLTTLGVLRGPDEPLLPQLGNGAEPAGGFYSQDE
VKAIVTHAAALNVEVVPEIDIPGHSTAALNALPELADGQEAPESYHSVQGYPNNALNPAV
PLTYEFLEKVFDEMVELFPSRYIHIGGDEVANGSWLASPLARKLMEEEGISSTFALQSYF
LKKVKQMLTARGRKLVGWNEVAHGGGVGTDDTLLMAWENPKVGIELAREGYEVVMTPGQA
YYLDMAQAEAWQEPGASWAGTATPAHTYGYEAEGEFPEELKGRMKGVQACIWSEHFLSRG
YFNRLVFPRLPAIAEAAWTPKAEKDWLRFAAIAPLSPTL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggtctcttatcgtctcgaatctgcctggcagccggacggtggccccttcgga
cgcttcactttcacgctcttcaacttgtccggcaggccgctcggcggcttccgtctcgtc
tatacctcgctcacccgcgtcatcgatccggcggcctgcgggaatgccgtcttcctgcgc
cgcaacgctaatttccacgagttcgcgccacccgagggcctgacccttcagcccggcgaa
agctggactttcctggtcagcggactgcaccggcaggccaagcattgcaccgatggggcg
aagtcggcctatctgacgctgtccgatggtcgccacgtgccggtggcggtgtcggatctt
cggctcgaaggagcgacaagcgaaccgccgccgcagcgcctgcccgaaggcaagcttgcg
ctgtccttcgcgttgcagccctggccagccgagatcgacgcggtgcccggagcagaagtg
ccggtcgtcctctatccggcatcggggagcaacacggaagagatcgacgcggtctccaac
gtgctagcgctgtttcaccggctgtttccggccggccacgctcccttcagcctggcggcc
tccggccagggattgccgatcgtcttcgaggagaagggcgaactcggtggcgaggcctac
aggctcgccttctccggccgcgatatccggcttgaatacggtgccgtgtcaggacggcaa
tatggcctgacgacgctcgtgcagctcctcgatagcgcccgcaatcatcccggcaaattc
cgctttccggcttcagggacgatatccgatcggccgcgttatggctggcgcggctgccat
ctcgacgtgtcgcggcaattctatccgaccgccgacgtcctgcggctgatcgacatcctt
gcctggttcaagctcaacatcttccattggcatctgaccgatgacgaggcctggcgcctg
gagatcaaggcctatccgacgctgacgacgctcggcgtcctgcgcgggccggacgaaccg
ttgctgccgcagctcggcaacggcgccgagccggcgggcggcttctacagccaggatgag
gtcaaggcgatcgtcacccatgcggcggcgctcaatgtagaggtcgtccccgagatcgac
attcccggccacagtacagcagcgctcaacgcgcttcccgagctcgccgacggacaggag
gcgccggagagctatcattcggtccagggctatcccaacaacgcgcttaatccggccgtt
ccgctcacctacgaattcctcgaaaaggtgttcgacgaaatggtcgagctgttcccgagc
cgatacatccacatcggcggcgacgaggtggcgaacggctcctggctggcctcgccgctg
gcgcgcaagctgatggaggaggagggcatttccagcactttcgcgttgcaatcctatttc
ctgaaaaaggtgaaacagatgctgacggcgcgcggacgcaagctggtcggctggaacgaa
gtcgcccacggcggcggcgtcggaaccgacgacacgctgctgatggcctgggagaacccg
aaggtcggcatcgaactcgcccgcgagggctatgaggtcgtgatgacccccggccaagcc
tattacctcgacatggcccaggcggaggcctggcaggaacccggcgcaagttgggccggc
acggcaacgccagcgcatacctatgggtatgaggcggaaggcgagtttccggaagagctg
aagggccgcatgaagggtgtccaggcctgcatctggtcggagcatttcctgtcgcgcggc
tatttcaaccggctcgtcttcccgcgtttgccggcgatcgccgaagcggcctggacgccg
aaggctgagaaggactggctgcgctttgccgcgattgctcctctgagcccgacgctgtga

DBGET integrated database retrieval system