KEGG   Sinorhizobium fredii HH103: SFHH103_05821Help
Entry
SFHH103_05821     CDS       T01731                                 

Gene name
glpK
Definition
putative glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SFHH103_05821 (glpK)
Enzymes [BR:sfh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SFHH103_05821 (glpK)
Exosome [BR:sfh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFHH103_05821 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:1048607..1050073
Genome map
AA seq 488 aa AA seqDB search
MRAILAIDQGTTNSKAILVSEAGAVISRGASPVGIYYPQPGWVEQDPKRIWQSVCEAVRA
CLDAGPDVSIEALAVSNQRESVTAWDAETGEPLGPVLSWQCRRTAPDCARLIDEGHLTRV
QSITGLPLDPMFPGPKLRRLLDDAPKGRRLRLGTIDSWLIHCLTGGRVHACDASNAARSQ
LFDLRAQTWSDELCTLFGVSKEALPQVLDSAGDFGSTLGLPGVADGTPIRAAIGDSHAAL
FAHRAFNPGDGKVTFGTGSSVMTTLSGFIAPAGGITTTVAWRISGTPTFAFEGNILVSAA
SLPWMTEILGLPDIGALIDLAATAEPGGPGFVPAFVGLGAPHWDSEARALFSRINFSTTR
AQMARAVTDSVALQVRDVFTAMQRQSRTGFGALYVDGGPSRNRFLMQCVADLLGHPIVQC
EAPEASALGAAYLAGLSLGIWPDLAAISDLPGNNELIRPQASDNSEQLQTWHDAVARSTF
RPSHAKGE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccattctggcaatcgaccagggaacgaccaactcgaaggcgatcctggtttcg
gaagccggcgcggtgatttctcgcggcgcgtctcccgtcgggatctattacccgcagccg
ggatgggtcgagcaggatccgaagcggatctggcaatccgtctgcgaagccgtgagggcc
tgtctcgatgcaggacctgacgtcagcatcgaagcgcttgccgtctcaaaccagcgggaa
tccgtcacggcctgggacgccgaaaccggtgagccgctcgggccggtgctgagctggcaa
tgccgccgtaccgcgccggactgcgcccggctcatcgacgagggtcacctcacccgggtc
cagtcgattacgggccttcccctcgacccgatgttcccgggcccgaagttgcggcggctc
ctcgatgacgcaccgaagggaaggcggctgaggctcggcacgatagacagctggctgatc
cattgcctcacgggcggccgggttcatgcatgcgacgcctcgaatgccgcacgcagccag
ctcttcgatcttcgggcgcagacctggagcgacgagctctgcacgctcttcggcgtgagc
aaggaagcgttgccgcaggtgctggacagtgcgggcgacttcggttcaaccctgggcctg
ccgggcgtcgccgacggcacccccatccgcgcggcgatcggcgacagccatgccgcgctc
ttcgcgcaccgcgccttcaatcctggagacggcaaggtcacctttggcacgggctcatcg
gtgatgacgacgctatcgggtttcatcgcacctgccggcggaatcaccacgacggtcgcc
tggcgcatctcgggaacgccgaccttcgccttcgagggcaacattctcgtttccgcggcg
agccttccatggatgaccgagattctcggcctccccgacatcggcgcgcttatagacctt
gccgcaacggccgagcccggcgggcctggcttcgtaccggcattcgtgggacttggcgcc
cctcattgggactccgaggcgcgcgccctgttttcccggatcaatttcagcacgacgcgc
gcgcagatggcgcgcgccgtcaccgactccgttgcgctgcaggttcgcgacgtcttcacc
gcgatgcagcgccagtctcggaccggcttcggcgccctttacgtcgatggcgggccgagc
cggaaccggtttctcatgcagtgcgtcgccgacctcctgggccacccgatcgtccagtgc
gaagctccggaagcctccgccctcggcgcggcctatctcgcggggctttcgctgggaatt
tggcccgatcttgcggcgatttccgatctgcccggaaataacgaactcattcggccgcaa
gcgagcgacaacagcgagcaacttcaaacctggcacgacgcagttgcccgctcgaccttt
cgtccctctcacgctaaaggtgaataa

DBGET integrated database retrieval system