KEGG   Sinorhizobium fredii HH103: SFHH103_05905Help
Entry
SFHH103_05905     CDS       T01731                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SFHH103_05905
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SFHH103_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(1143580..1143993)
Genome map
AA seq 137 aa AA seqDB search
MASRLGDLVAAGLVFGGVLAGAAEPAVALDPAAGDPAAGEKVFRKCQACHAIGPDAKSKT
GPALTGIIGRPAGKTEGFSYSTAMSKVAETGLVWTPDKIGEFLTNPKGFLPGTKMTFAGL
RKDQERADLIAYLAKFP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaagacttggtgacctagttgcggctggactcgtattcggtggagttcttgca
ggcgcggctgaaccggcagttgcgctggatcctgcagcaggcgatccagcggcgggtgag
aaagtctttcgcaagtgtcaggcctgtcacgcgatcggtccggatgcgaagtcaaagacc
ggcccagcgctgaccggcataatcggccggccagccggcaaaacggaaggcttcagctat
tccactgcgatgagcaaggtggccgagaccggcttggtctggacgccggacaagatcggc
gagtttctgacaaacccgaaagggttcctgcccggcacgaagatgacctttgcgggattg
cgcaaggatcaggagcgcgccgatctgatcgcatatttggcgaagtttccttaa

DBGET integrated database retrieval system