KEGG   Sinorhizobium fredii HH103: SFHH103_05961Help
Entry
SFHH103_05961     CDS       T01731                                 

Definition
putative asparagine synthase,glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sfh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(1201006..1202967)
Genome map
AA seq 653 aa AA seqDB search
MCGIAGLIDHAQRGREEVAQILTRMTDALAHRGPDASGTWLDNAGRVGLGHRRLSIIDLS
PTGAQPMHSSSGRYSIVFNGEIYGFLGLRAALEEQGARFRGHSDTEVLLEAIETYGLESA
LQRCNGMFAFALFDSATRHIIFARDRIGKKPLYIGVSKSGVAFGSELKSIRAHPSFRSVE
VDPQAATLFLRYGYVPTPYSIYRGIFKLPHGSWLSLSVDTPPASASTALSGVKRYWDAFE
AAERGYAQRIECPDEALDALDAELKRAVSERLVSDVPVGALLSSGVDSSLVSAVMQEVST
SRVKTYTVRFLEEQYNEADLASGIARQLGTDHTEITAEPDTALRIVSELPDVYDEPFADP
SQIPTLLVSKLARRTVTVALSGDGGDEFFGGYKRYRQMLAFDRLARKTPAVALRAARHAP
HWALEFAAAAAHHARPSSLQDEVTGKRLRRLAELLEIKDPDARYLDFRSLWSHPADVVFG
GAEPPTAMTSKRIPACLGAVDRMMYRDMVDYLPDDILVKMDRASMAVGLEMRAPLLDYRF
VELAWRAPRALCFAEAPGKPALRKLLSRRLPEQFINLSKRGFGVPVNAWLRGPLRAWAEE
MLSPSRLQRDGVFRAEPIVSRWEAHLAGRIDWGPQLWAVLMFNLWHDRWVRSD
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgccggcctgatagatcatgcgcagcgcggtcgggaggaagtggcgcag
atactgacgcgcatgacggacgccctcgctcaccgcgggcccgatgcgtcgggtacctgg
ctcgataacgcgggccgcgtagggctcggacaccgccgcctgtccatcattgacctctcc
cccacgggtgcccagcctatgcattcgagcagtggccgctactcgatcgtcttcaacggc
gagatctacggattccttggcctgagggccgcattggaggagcagggcgctcgcttccgc
ggtcactccgataccgaagtgctcctggaggcgatagagacctacggcttggaaagtgca
ttgcagcgctgcaacggcatgttcgcctttgcgcttttcgacagtgccacgcgacatatc
atcttcgctcgcgaccgtataggaaagaagccgctgtatatcggcgtatccaagagcggc
gttgccttcggctccgagctgaaaagcatcagggcgcatccgtccttccgctccgttgaa
gtagacccccaggcggccacgcttttcctgcgatacggctacgtgccgacgccttattcg
atctaccgcggcatcttcaagcttccgcatggctcttggctgagcctctcggtcgatacg
ccgccggcgtcggcgtcgaccgccctgagcggggtcaagcgctattgggatgctttcgaa
gcggcggaacgaggctatgcgcagcggatcgaatgcccggacgaagccttggacgcgctc
gacgccgaattgaaacgggcggtgagcgagcgccttgtctccgacgtgccggtgggagcc
ctcctttccagcggcgtcgattcttccttggtatcggccgttatgcaggaagtttcgacc
tcgcgtgtaaaaacctataccgtgcgcttcctggaggagcagtataacgaggcggatctg
gcgtcaggcatcgccaggcagctcggcaccgatcatacggagatcacggcagaacccgac
accgcactgcgcatcgtaagcgagttgccggatgtgtatgacgagcccttcgccgaccct
tcacagattccgacgctgcttgtatcgaagctggcgcgaagaaccgtaacggtggcgctc
tcgggtgatggcggagacgagttcttcggcggctacaaacgctatcggcaaatgctcgcc
ttcgaccggctggcgaggaaaacgcctgccgttgctctcagggcggcaaggcacgcacct
cattgggcgctggaatttgccgccgcggcggctcatcatgcgcgtccgtcttcgcttcag
gacgaagtgaccggcaaacggctaagaagacttgccgagctcctggagatcaaggacccg
gacgcccgctacctggactttcgttcgctctggtcacatccggccgatgtcgtgttcggc
ggagcagagcctccgaccgccatgacctcgaagcggataccggcttgcctgggcgcagtc
gacagaatgatgtaccgcgacatggtcgactatctgcccgacgacatcctcgtgaagatg
gatcgagcttcgatggcggtgggcctggagatgcgcgctccgttgctcgattaccgcttc
gtcgaactggcctggcgtgcgccaagggcgttgtgttttgccgaagccccgggtaagccc
gcgctgcgcaagctcttgtcccgaaggctgccggaacaattcataaatctttcaaagcgc
ggattcggcgtccccgtcaacgcttggttgcgcggaccgctgcgcgcctgggcagaagag
atgctgtcgccctctcgcctgcagcgtgatggagtcttccgcgccgagccgatcgtcagt
cgctgggaggcacatcttgccggccgcatcgactggggtccgcaattgtgggcggtgctg
atgttcaacctgtggcacgaccgctgggtgcgctccgactga

DBGET integrated database retrieval system