KEGG   Sinorhizobium fredii HH103: SFHH103_05998Help
Entry
SFHH103_05998     CDS       T01731                                 

Gene name
fucA
Definition
putative L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SFHH103_05998 (fucA)
Enzymes [BR:sfh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SFHH103_05998 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(1238833..1239537)
Genome map
AA seq 234 aa AA seqDB search
MAENPTTDKLALRREMVDICRRMNTSGINQGTAGNLSVRAGDGFLITPSSMPYDTMQPED
LVEMAFDGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATTLACHHRTIPSFHYMT
GIAGGTTIRCAAYATFGTQALSDNALVALKDRTACLLGQHGQISLGKTLESALWLAIEVE
TLSRIYVQALTLGEPPILPEDEMERVIAQMQRMSYGQAPDAEGVNDVARPRGEA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacccgacgaccgacaagctggcgctcaggcgcgagatggtggacatctgc
cggcggatgaatacgagcggcatcaaccagggcacggccggcaacctttccgtccgggcc
ggtgacggattcctgatcaccccctcgtccatgccctatgacacgatgcagccggaagac
ctggtcgagatggcgttcgacgggacctatgtcggccaccgaccgtcgtccgaatggcgt
ttccatcgcgatattctgcgcgcccgcaccgatatcgacgtcgtgctgcattgccactcg
atctatgcgacgacgcttgcctgccaccacaggaccattccgagcttccactacatgacg
gggattgccggcggcacgacgatccgctgtgccgcatacgccaccttcggcacgcaggcg
ctctccgacaacgcgctcgtcgcgctcaaggaccgcaccgcctgtctgctcggccagcac
ggccagatctcgcttggcaagacgctcgaatcggcgctctggctcgccatagaggtcgag
acgctgtcgcggatctatgttcaggccctcacgcttggcgagccgccgatcctgcccgaa
gacgagatggagcgcgtcatcgcccagatgcagcggatgagctacggccaggcgccggat
gcggagggggtgaacgatgttgcccgcccgcgtggcgaggcgtga

DBGET integrated database retrieval system