KEGG   Sinorhizobium fredii HH103: SFHH103_06166Help
Entry
SFHH103_06166     CDS       T01731                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sfh02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sfh02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(1403787..1404830)
Genome map
AA seq 347 aa AA seqDB search
MTRILLATSTPDLEERVRRAAGADAAIELVGVARSGKDAVRMTGKLLPDIVAVELRDNDT
AETVREIMIIAPTPVVMVAYQDGSQLGAISARALDSGALAVIPAPTASGTSLEKAAIERF
LSTIKAMAQVKVVRQWRKKTRGDHQVKEAPQSADDTQIAIVGIAASTGGPSAIRSILKDL
SANFPAPILIVQHMSNGFIEGVAASLDATIALKVKVGANGERLRPGTVYLAPDGHQLGVS
GKSRLRVVDDDPIQGFKPSGSYLFGSIARAFKEESLAVILTGMGDDGTEGLRALHVAGGK
VIAQDEESSVVFGMPKSAISAGLVDFVLPLDDIAGKITALASRRRQP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtattctccttgcgacatcgacgccagatcttgaagaacgcgtcagaagggcg
gcaggcgccgacgccgccatagagctcgtgggcgtcgcaagaagcggcaaggacgcagtt
aggatgaccggtaaacttttgccggacatagtcgcagtggaactccgcgacaacgacacc
gccgaaaccgtcagagagatcatgatcatcgcaccgacgcctgtggtcatggtggcctac
caggatggttcgcaactgggggccatctccgcgcgggcgctcgactcgggcgcgctcgcg
gtcatcccggcgccgaccgcatccggcacgtctctcgaaaaagcggctatcgaaaggttc
ctgtcgacgatcaaggccatggcgcaggtcaaggtcgttcgccagtggcgcaagaagacg
cgcggcgatcaccaggtcaaagaggcaccgcagtcggcggacgacacccagatcgcgatc
gtgggcatcgccgcctccacaggaggaccgtccgcgatccgttcgatattgaaggacctc
tccgcaaattttcctgcgcccatcctcatcgtgcagcacatgtcgaacggcttcatcgaa
ggcgttgccgcatccctcgacgccacaattgccctcaaggttaaagtcggtgcgaatggc
gaacgcctgaggcctggcactgtttacctcgcccctgacggccaccagctcggcgtctcg
ggcaagtcgcgcctgcgtgtcgtggacgacgatcccatacagggcttcaagccgtccgga
tcctatctgttcggctcgatcgctcgcgctttcaaggaggagtctcttgcggtcatcctg
actgggatgggcgatgacggcaccgagggccttcgggcgctgcacgtggcgggcgggaag
gtgatcgcgcaggatgaagaaagctccgtcgtcttcggaatgccgaaatcggcaatctct
gccggtctcgtcgatttcgttctgccgctggacgatatagccgggaagatcaccgcgctg
gcgagccgaagacgccaaccctga

DBGET integrated database retrieval system