KEGG   Sinorhizobium fredii HH103: SFHH103_06483Help
Entry
SFHH103_06483     CDS       T01731                                 

Definition
putative MCD, Malonyl-CoA decarboxylase MCD (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SFHH103_06483
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SFHH103_06483
Enzymes [BR:sfh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     SFHH103_06483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:1731510..1732931
Genome map
AA seq 473 aa AA seqDB search
MPGTSFFSDMLQGITERGRKLLFAGPRSADVAVEANLEALCEMLLSSRGEASGMAIAAEI
LGRWSKLDSAGLEQFLQMLSQKFGADTAKLDKAVDRYRTEKSPSAIIALHKAAEPRRQEL
LRRLNHAPSGTAKLVRMRQQLLASKDRSAEFRAVDSDFAHLFSSWFNRGFLTLRPIDWST
PAHILEKIIKYEAVHEIAGWEELRRRLAPADRRCFAFFHPRLTDEPLVFVEVALARSVPG
AIKDVLDESREQIDPDQATTAVFYSISNCQEGLRGISFGNFLIKQVVEDLRRDLPGLRNF
VTLSPVPGFARWLARARSSDAEPLLTDEERKALGLLDDRAWADDPSAASEIERVLLPLAA
HYFLIERTPEGRPLDSVARFHLGNGARLERLNFLGDRSAKAMQQAHGLMVNYLYKLEDIE
ANHEALAQRGEVTASPVVKGLLGRNGESRRGSRSEMSRPFAQVMNDKIGGGRK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacctcgtttttcagcgatatgctgcaaggcatcaccgaacgcggccgcaag
ctgctgtttgccggtccgcgctccgcggatgtcgcagtcgaagcaaatctcgaggccctt
tgcgaaatgctgctgtcgagccgcggtgaagcatccggcatggccatcgccgccgagatc
ctcgggcgctggagcaagctcgacagcgccggccttgagcaattcctgcagatgctctct
caaaaattcggcgccgatacggcgaagctcgacaaggcggtcgaccggtaccgcaccgag
aagagcccgtcggcgatcatcgcactccacaaggcggcggaaccacgccgtcaggaattg
ctgcgccggttgaaccatgcaccgagcggtacggccaagctggttcggatgcgccagcag
cttctcgcctccaaggaccgatcggccgaatttcgcgccgtcgacagcgacttcgcccat
ctgttcagctcctggttcaatcgcggcttcctgacgctccgtcccatcgactggtctacg
ccggcacacatcctggaaaagatcatcaaatacgaggcggtgcacgaaatcgccggctgg
gaggagttgcgccgacgcctggcgccggccgaccgacgctgcttcgccttcttccacccg
cggctcaccgacgagccgctcgtcttcgtcgaggtggcgcttgcccgatccgtgccgggc
gccatcaaggacgtgctcgacgaaagccgcgagcagatcgatcccgatcaggcgacgacc
gccgtcttctattcgatctccaattgccaggagggcctgcgcggcatctcgttcggcaat
ttcctcatcaagcaggtcgtcgaggacctgcgcagggacctgcccggcctcaggaacttc
gtcacgctttcgccggttccgggctttgcccgctggcttgccagggcgcgcagttcggac
gccgagccgctgctgaccgacgaggagcgcaaggctctgggcctgctcgacgaccgcgca
tgggccgacgacccgagcgcggcaagcgagatcgaacgcgtgctgctgccgctcgcagcc
cactatttcctgatcgagcgcacgccggagggtcgcccgctcgattcggtcgcccgcttc
catctcggcaatggcgcccgcctggaaaggctgaattttctcggcgaccgctcggccaag
gcgatgcagcaggcacacgggctgatggtcaattatctctacaagctcgaggacatcgag
gccaaccacgaggccctggcgcagcgcggcgaggtcaccgcatcgccggtcgtcaagggc
ctgctcggccgaaacggcgaaagccgccgcggcagcaggagcgaaatgtcacgaccgttc
gcacaggtcatgaacgacaagattggaggagggcgcaagtga

DBGET integrated database retrieval system