KEGG   Sinorhizobium fredii HH103: SFHH103_06492Help
Entry
SFHH103_06492     CDS       T01731                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sfh  Sinorhizobium fredii HH103
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sfh00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSfHH103e:complement(1745701..1747173)
Genome map
AA seq 490 aa AA seqDB search
MGSFKIAIIGAGSVGFTKKLFTDILSVPELRDVEFALTDLSEHNLGMIKTILDRIVEANG
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGAKDGELDYVCSGINHQTWFIDVRLNGRKIGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITKWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLSTIKRSNEHASHILEALETGRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVSGITIPEACAATCISSINVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAEWLPQYAHAVAAAKERLSRSTVKTREWTGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttcaagatcgccattatcggcgccggcagcgtcggtttcaccaagaagctt
ttcaccgatatcctgtccgtgccggagctccgcgacgtcgagttcgccttgacggatctg
agcgagcacaatctcggcatgatcaagacgatcctcgaccggatcgtcgaggcgaacggg
ttaccgacgcgcgtgacggcaaccaccgatcgccgcaaggcgctcgagggcgctcgctac
atcatcagctgcgttcgggtcggcggcctcgaggcgtatgcggacgacatccgcattccg
ctgaaatacggtgtcgaccagtgcgtcggcgatacgatctgcgccggcggcattctgtat
ggccaacgcaacatcccggtgatcctcgacttctgcaaggacatccgcgaggtggccgag
ccgggcgcaaagttcctgaactatgccaacccgatggcgatgaacacctgggcggcgatc
gaatacggcaaggtcgacacggtcggtctctgccatggcgtccagcacggcgccgagcag
atcgccgagatcctcggcgcgaaggacggcgaactcgactatgtctgctccggcatcaac
caccagacctggttcatcgacgtccgcctcaacggtcgcaagatcggcaaggatgagctg
gtggccgccttcgaggcccatccggtcttctccaagcaggagaagctcaggatcgacgtg
ttgaagcgcttcggagtctattcgacggagagcaacggccatctctccgaataccttccc
tggtaccgcaagcgccccgacgagatcaccaaatggatcgacatgtcggactggatccat
ggcgagaccggcgggtatctgcgctattcgaccgagacccgcaactggttcgagacggaa
tatccgcgcttccttgaagaggcgggcaggccgctttcgacgatcaagcggtcgaacgag
catgcgagccacatcctcgaagcgctcgagaccgggcgcgtctatcgcggccacttcaac
gtcaagaacaacggcgtgatcaccaacctgccggcggacgcaatcatcgaatctcctggc
ttcgtcgatcgcttcggcattaacatggtgtccggcatcacgatccccgaggcctgtgcc
gccacctgtatctcgtcgatcaatgtccagcgcatgtccgtgcatgcggcgatcaccggc
gacatagatcttctgaagctcgcggtgctgcacgacccgctggtcggggcgatctgcacg
ccggaggaggtctggcagatggtcgacgagatggtcgtcgcccaggctgaatggctgccg
caatacgcccatgccgtcgcggcggccaaggagaggctctcccggtcgacggtgaagacc
cgcgaatggacgggtgctgcgcggcgcgaggtacgctccatcgaggaaatccgcgccgag
aaggaagccgcgaagttgcgcgccgccgggtag

DBGET integrated database retrieval system