KEGG   Streptomyces fulvissimus: SFUL_1421Help
Entry
SFUL_1421         CDS       T02650                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sfi  Streptomyces fulvissimus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SFUL_1421
Enzymes [BR:sfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SFUL_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1599579..1600238)
Genome map
AA seq 219 aa AA seqDB search
MSEQQPESVARAWREVVDTARRSAADGLVVGTSGNVSARVGELVLVTPSGVPYDRLRPDD
AVGVDLTGRQVLGELRPTSELPLHLAVYRETGAAAVVHTHAVHATAVSTLVTEVPLVHYA
AAILGGPVRTAAYARYGTPELADAMLAALRGRTGCLLANHGTVTYGATLDQAYERTAQLE
WLCRLWLTASAVPGHRPALLTPAQLDEVTEALKGYGQPG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagcagccggaatccgtcgcccgggcctggcgggaggtggtcgacaccgcc
cgccggagcgccgccgacggcctcgtcgtcggcacctccggcaatgtgtcggcccgcgtc
ggggagctggtcctggtgacccccagcggggtgccctacgaccggctccggccggacgac
gccgtcggggtcgacctgaccgggcgccaggtcctcggagagctcaggccgaccagcgaa
ctccccctccacctcgcggtctaccgggagaccggcgccgccgccgtggtccacacccac
gccgtgcacgccaccgctgtctccaccctcgtcaccgaggtgccgctcgtgcactacgcg
gccgccatcctcggcggccccgtccgcaccgccgcctacgcccgctacggcacccccgaa
ctggccgacgccatgctcgccgccctccggggccgcaccggctgcctgctcgccaaccac
ggcaccgtcacctacggcgccaccctcgaccaggcctacgagcgcaccgcccagctggag
tggctctgccgcctctggctcaccgcgagcgccgtccccggccaccggccggccctgctg
acccccgcccagctggacgaggtgaccgaggcgctcaaggggtacgggcagccgggctga

DBGET integrated database retrieval system