KEGG   Streptomyces fulvissimus: SFUL_1530Help
Entry
SFUL_1530         CDS       T02650                                 

Definition
Aminotransferase class I and II (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sfi  Streptomyces fulvissimus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SFUL_1530
   01230 Biosynthesis of amino acids
    SFUL_1530
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SFUL_1530
   00290 Valine, leucine and isoleucine biosynthesis
    SFUL_1530
Enzymes [BR:sfi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SFUL_1530
    2.6.1.66  valine---pyruvate transaminase
     SFUL_1530
Amino acid related enzymes [BR:sfi01007]
 Aminotransferase (transaminase)
  Class I
   SFUL_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1718199..1719410
Genome map
AA seq 403 aa AA seqDB search
MEFRQSSKLNEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPALFGFEAPEEIVQDMIRM
LPQAHGYTDSRGILSARRAVAQRYQAMGLTEVGVDDIFLGNGVSELISMAVQALLEDGDE
VLIPAPDFPLWTAVTTLAGGKAVHYICDEESDWNPDLADMASKITDRTRAVVIINPNNPT
GAVYPREILEGILDLARRHGLMVFADEIYDQILYDGAEHHSAAVLAPDLVCLTFSGLSKT
YRVAGFRSGWLVVSGPQQHARNYLEGLTMLASMRLCPNAPAQYAIQAALGGRQSIRELVA
PGGRLHEQRDRAWERLNEIPGVSCVKPKGALYAFPRIDPKVHPIVDDEKFVLDLLLREKI
QVVQGTGFSWPRPDHFRILTLPYADDLDAAISRIGRFLNGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtccagcaagctcaacgaggtctgttacgagatccggggcccggtc
atcgagcacgccaacgccctggaggaggcgggccacagcgtgctccggctcaacacgggc
aacccggcgctcttcggcttcgaggcgccggaggagatcgtccaggacatgatccggatg
ctgccccaggcccacggctacaccgattcgcgcggcatcctctccgcgcggcgggcggtg
gcgcagcgctaccaggccatggggctcaccgaggtcggcgtggacgacatcttcctcggc
aacggggtctccgagctgatctccatggccgtgcaggcgctgctggaggacggcgacgag
gtactgatcccggccccggacttcccgctctggacggccgtcaccacgctcgcgggcggc
aaggccgtgcactacatctgcgacgaggaatccgactggaacccggacctcgccgacatg
gcgtcgaagatcaccgaccggaccagggccgtcgtgatcatcaacccgaacaaccccacc
ggggcggtctatccgcgcgagatcctcgaaggcattctcgacctggcccgcaggcacggg
ctgatggtcttcgccgacgagatctacgaccagatcctgtacgacggagccgagcaccac
agcgccgccgtcctcgccccggacctggtctgcctcaccttcagcgggctctcgaagacg
taccgggtggccgggttccgctccggctggctggtggtgtccggcccgcagcagcacgcc
cgcaactatctggagggcctcaccatgctggcctccatgcggctgtgccccaacgccccc
gcgcagtacgccattcaggccgcgctcggcgggcggcagtccatccgggagctggtggcg
ccgggcggcaggctgcacgagcagcgggaccgggcctgggagcggctgaacgagatcccc
ggggtctcgtgcgtgaagccgaagggcgcgctgtacgcgttcccgcgcatcgatccgaag
gtgcaccccatcgtcgacgacgagaagttcgtgctggacctgctgctgcgggagaagatc
caggtggtgcagggcaccggcttcagctggccgcgcccggaccacttccgcatcctgacc
ctcccgtacgccgacgacctcgacgcggcgatcagccgcatcggccgcttcctgaacgga
taccgccagtga

DBGET integrated database retrieval system