KEGG   Streptomyces fulvissimus: SFUL_1640Help
Entry
SFUL_1640         CDS       T02650                                 

Definition
Alkaline phosphatase Precursor (EC:3.1.4.4 3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sfi  Streptomyces fulvissimus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SFUL_1640
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SFUL_1640
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SFUL_1640
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SFUL_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1843331..1845028
Genome map
AA seq 565 aa AA seqDB search
MTSRHVPSPSRRTVVRAAAATAAAVPVLAASATTAVSASASASSEAAAPAFLHGVASGDP
LPDGVLLWTRVTPEPGAEPGSGRGADTPVRWEIAEDREFTAIAASGTTHASAASDHTVKA
DVRGLRPATSYYFRFTASGGGGEGGGTTGVRSPVGRTRTAPATGANVAGVRFGVVSCANW
EAGWFSAYRHLAARADLDAVLHLGDYLYEYAAGGYPTQGAALREHRPSHEILNLADYRLR
HGTYKTDTDLQALHAAHPVIAIWDDHEFANDAWSDGAQNHTPGAEGVWERRVAAAKQAYF
EWMPVRASTEGTVYRRLRFGKLADLHLLDLRSFRSEQASIGSGSVDDPERTVTGRAQLDW
LKAGLAGSDAVWKLVGTSVMISPVAFGALPAHLLKPLAGLLGLPKEGLAVNVDQWDGYTD
DRRELIAHLRERGISDTVFLTGDIHMAWANEVPVRAATYPLSPPAATEFVVTSVTSDNLD
DILKVAPQTVSLVAAAAVRAASRHVKWVDMDSHGYGVLDVTAERSQMDYYVLSDKTAKDS
TSSWARSYRTRRGTQRVERADRPVR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtcgacacgttccctcgccgagccgccgcacggtcgtccgggccgccgccgcg
accgccgccgccgtccccgtactcgccgcctcagccaccaccgccgtctcagcctcagcc
tccgcctcgtcggaggcggcggcccccgccttcctgcacggcgtcgcctcaggtgacccg
ctgcccgacggcgtcctgctgtggacccgcgtcacccccgagcccggcgcggagcccggt
tcggggcgcggggccgatacaccggtgcgctgggagatcgcggaggaccgggagttcacc
gcgatagccgcgagcggtacgacgcacgcctcggccgcctccgaccacacggtgaaggcc
gacgtccgcgggctgcggcccgccacctcgtactacttccgcttcacggcgagcggcggg
ggcggcgagggcggcgggaccaccggggtccgctcccccgtcggccgcacccgcacggcg
cccgccaccggggcgaacgtcgccggggtgcgcttcggtgtggtgtcgtgcgccaactgg
gaggcgggctggttctccgcgtaccggcatctcgccgcccgggccgatctggacgcggtg
ctgcacctgggcgactacctgtacgagtacgcggccggcggctacccgacccagggcgcg
gccctgcgcgagcaccggccctcccacgagatcctgaacctggccgactaccgcctgagg
cacggcacctacaagaccgacaccgacctccaggcgctgcacgccgcgcacccggtcatc
gcgatctgggacgaccacgagttcgcgaacgacgcctggtcggacggcgcgcagaaccac
accccgggcgcggagggggtgtgggagcggcgggtggcggcggccaagcaggcgtacttc
gagtggatgccggtccgcgcctccaccgaggggaccgtctaccggcggctgcggttcggg
aaactggccgatctgcacctgctggacctgcggagcttccgatccgagcaggcgtccatc
ggcagcggctcggtggacgacccggagcgtacggtcaccggccgggcgcagctggactgg
ctgaaggcggggctggccgggtcggacgcggtgtggaagctggtcggtacgtcagtgatg
atctcgccggtcgccttcggtgctctccccgcccatctgctgaagccgctggccgggctg
ctggggctgccgaaggagggactcgcggtcaacgtcgaccagtgggacgggtacaccgac
gaccgccgggagctgatcgcgcatctgcgggagcgcgggatcagcgacacggtgttcctg
accggtgacatccacatggcctgggccaacgaggtgccggtgcgggcggcgacgtatccg
ctgtcgcccccggcggcgacggagttcgtcgtcacgtcggtgacctcggacaacctggac
gacatcctgaaggtcgcgccgcagaccgtgtcgctggtcgcggcggcggccgtccgtgcc
gccagccgccatgtgaagtgggtggacatggactcgcacgggtacggcgtcctggacgtc
accgccgagcgctcacagatggactactacgtgctctccgacaagacggccaaggactcc
acctcctcctgggcccgctcctaccggacgcgccggggcacgcagcgggtggagcgggcg
gaccgcccggtccgctga

DBGET integrated database retrieval system