KEGG   Streptomyces fulvissimus: SFUL_1697Help
Entry
SFUL_1697         CDS       T02650                                 

Definition
esterase/lipase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sfi  Streptomyces fulvissimus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1907758..1908537
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPFRHEGGEVGVLLCHGFTGSPQSLRPWADFLAERGLTVSLPLLPGHGTRWED
MAVTGWQDWYAEVDRELRVLRERCDQVFVFGLSMGGALSLRLAAKHGDAISGLVLVNPAN
KVHGLSAYALPVARHLVRTTKGLADDIALPGSHEVGYDRVPLHAAHSVRKFFRLVDGELP
QVTQPLVVLHSPQDHVVPPADSARILSRVSSTDVSEILLEQSYHVATLDHDAERIFDESY
RFIGRLAPSVGMKGSTSGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtcctccctggagccgagccgttccgccacgagggcggagaggtcggcgtcctc
ctctgtcatggcttcaccggatcgccgcagtcgctgcgtccctgggccgacttcctcgcc
gagcgcgggctgaccgtctcgctgccgctgctgccgggccacggcacccgctgggaggac
atggcggtcaccggctggcaggactggtacgcggaggtggaccgcgagctgcgggtgctg
cgcgagaggtgcgaccaggtcttcgtcttcgggctctccatgggcggtgcgctgagcctg
cgtcttgcggccaagcacggggacgcgatcagcggtctggtgctggtgaacccggcgaac
aaggtgcacggcctctccgcgtacgcgctgccggtcgcccgccatctggtgcggacgacc
aaggggctcgccgacgacatcgcgctgccgggctcgcacgaggtcggttacgacagggtg
ccgctgcacgccgcccactcggtgcggaagttcttccggctggtcgacggggaactgccc
caggtgacccagccgctggtggtgctgcacagcccgcaggaccatgtcgtaccgcctgcg
gacagcgcgcggatcctgagccgggtctcctccacggatgtctcggagatcttgttggaa
cagagctaccacgtggcgacgttggaccatgatgcggagcggatcttcgatgagagctac
cggttcatcggccgtctcgcaccgagcgtcgggatgaaggggagcacgtccggtggctga

DBGET integrated database retrieval system