KEGG   Streptomyces fulvissimus: SFUL_1697Help
Entry
SFUL_1697         CDS       T02650                                 

Definition
(GenBank) esterase/lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sfi  Streptomyces fulvissimus
Brite
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SFUL_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 UPF0227 Ndr Abhydrolase_5 Abhydrolase_3 BAAT_C Thioesterase Esterase Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AGK76665
UniProt: N0CM52
Position
1907758..1908537
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPFRHEGGEVGVLLCHGFTGSPQSLRPWADFLAERGLTVSLPLLPGHGTRWED
MAVTGWQDWYAEVDRELRVLRERCDQVFVFGLSMGGALSLRLAAKHGDAISGLVLVNPAN
KVHGLSAYALPVARHLVRTTKGLADDIALPGSHEVGYDRVPLHAAHSVRKFFRLVDGELP
QVTQPLVVLHSPQDHVVPPADSARILSRVSSTDVSEILLEQSYHVATLDHDAERIFDESY
RFIGRLAPSVGMKGSTSGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtcctccctggagccgagccgttccgccacgagggcggagaggtcggcgtcctc
ctctgtcatggcttcaccggatcgccgcagtcgctgcgtccctgggccgacttcctcgcc
gagcgcgggctgaccgtctcgctgccgctgctgccgggccacggcacccgctgggaggac
atggcggtcaccggctggcaggactggtacgcggaggtggaccgcgagctgcgggtgctg
cgcgagaggtgcgaccaggtcttcgtcttcgggctctccatgggcggtgcgctgagcctg
cgtcttgcggccaagcacggggacgcgatcagcggtctggtgctggtgaacccggcgaac
aaggtgcacggcctctccgcgtacgcgctgccggtcgcccgccatctggtgcggacgacc
aaggggctcgccgacgacatcgcgctgccgggctcgcacgaggtcggttacgacagggtg
ccgctgcacgccgcccactcggtgcggaagttcttccggctggtcgacggggaactgccc
caggtgacccagccgctggtggtgctgcacagcccgcaggaccatgtcgtaccgcctgcg
gacagcgcgcggatcctgagccgggtctcctccacggatgtctcggagatcttgttggaa
cagagctaccacgtggcgacgttggaccatgatgcggagcggatcttcgatgagagctac
cggttcatcggccgtctcgcaccgagcgtcgggatgaaggggagcacgtccggtggctga

DBGET integrated database retrieval system