KEGG   Streptomyces fulvissimus: SFUL_2149Help
Entry
SFUL_2149         CDS       T02650                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sfi  Streptomyces fulvissimus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SFUL_2149
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SFUL_2149
Enzymes [BR:sfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SFUL_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2404221..2405435)
Genome map
AA seq 404 aa AA seqDB search
MAEQRPSDRTVSDGTASDRELLDRTPSGRGPEVTGARRIVVKVGSSSLTTASGGLDADRV
DALVDVLAKVRDGGEREVVLVSSGAIAAGLAPLGLVRRPKDLARQQAAASVGQGLLVARY
TASFARYGVRVGQVLLTADDTSRRAHYRNAYSTLDKLLEMGAVPVVNENDTVATDEIRFG
DNDRLAALVAHLVHADLLVLLSDVDGLYDGPPGTPGASRIAEVTGPDDLAGVTIGSAGKA
GVGTGGMVTKVEAARIATAAGVPVVLTSASRAADALAGRDTGTYFHRTGRRSADRLLWLA
HASTPQGALTLDDGAVRAVVERRTSLLPAGISAVEGEFSAGDPVELRDLRGTPVARGLVN
FDAKEIPQLLGRSTRDLARELGPAYEREVVHRDDLVILVPRLTP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagcagaggccgtcggaccgtacggtgtcggacggtacggcgtcggaccgcgag
ctgttggaccgcacgccgtcgggccgcgggccggaagtgaccggcgcccgcaggatcgtc
gtcaaggtcggctcctcctcgctcaccaccgcctccggcggcctcgacgccgaccgggtc
gacgccctcgtcgacgtcctggccaaggtcagggacggcggcgaacgcgaggtcgtcctc
gtctccagcggtgccatcgccgccgggctcgccccgctcggcctggtccgcaggcccaag
gacctcgcccgccagcaggccgccgccagcgtcggccagggcctcctcgtcgcccgctac
accgcctcgttcgcccgctacggcgtccgcgtcggccaggtgctcctcaccgccgacgac
accagccgccgcgcccactaccgcaacgcctacagcaccctcgacaagctcctcgaaatg
ggcgccgtccccgtcgtcaacgagaacgacaccgtcgccaccgacgagatccgcttcggc
gacaacgaccggctcgccgccctcgtcgcccacctcgtccacgccgacctcctggtcctg
ctctccgacgtcgacggcctctacgacggcccgcccggcacccccggcgcctcccggatc
gccgaggtcaccggccccgacgacctggccggcgtcaccatcggcagcgccggcaaggcg
ggcgtgggcaccggcggcatggtcaccaaggtcgaggccgcccgcatcgccaccgccgcc
ggcgtcccggtcgtcctcacctccgccagccgggccgccgacgccctcgcgggccgcgac
accggcacctacttccaccgcaccggccgccgctccgccgaccggctcctgtggctcgcc
cacgcctccaccccgcagggcgcgctcaccctggacgacggcgccgtacgggccgtggtg
gagcgccgcacctcgctgctgcccgccggaatctccgccgtcgagggcgagttcagcgcc
ggcgacccggtggagctgcgcgatctgcgcggcaccccggtcgcccgcggactcgtcaac
ttcgacgcgaaggagatcccccagctgctcggccgctccacccgcgatctggcccgtgag
ctgggccccgcctacgagcgcgaggtcgtacacagggacgatctcgtcattctcgtgcca
cgcctcaccccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system