KEGG   Streptomyces fulvissimus: SFUL_261Help
Entry
SFUL_261          CDS       T02650                                 

Definition
Glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sfi  Streptomyces fulvissimus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SFUL_261
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SFUL_261
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SFUL_261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283244..285142
Genome map
AA seq 632 aa AA seqDB search
MPHTRPLRLRARATGAALVVTVAGLGVNATVTTARAADPVAQVWVTTADGSKKLTAEGSV
PFTGAPQGVDIRIDANSKGQKFTGAGASVTGASAHLVQGLPQAQRTSLLRSLFSSEGDGI
GLNYLRQPLGSTDFDANANAYTYEDTRGSFSIDRDRGQIIPVLKQATAINPAIRFMGSPW
SPPAWMKTNNSLNGGSLRTEHYQAYADYLVKAIRAYGQEGITLTDLTAQNEPEFATSYPS
MSMTAAQQADFFQVLDRTLTAANLPTNLLAYDHNWDHPNYPLDVFARTGGIQRIIGAAFH
CYGGAVGAQQQIVNAGKRVFFTECSGTDSTNPATTFGDTLKWHTENLVVQNMRNGGETVV
NWNLALDRNGGPHQGHCTNRCNGIVEIDGGQVTRNAEYYVLGHVTKFIRPGATRIGSTSQ
GAGGVQNVAFQNTDGSRAAVVVNTASNSQRFSLTDNGKSLAFTLPAGAVATFTWDGSGGT
TEPPVGSIDPAAWYRVQNTNSGACLDAADWGTGDGTALQQWACGTGANQGWQFRPADGGH
YQVVNRHNAKVWDVDGGAGATADGTKVHLWSSVGSTNQQWRPEPLATSGRYRFVARHSGK
CLTVDGSSTANGAKLSQQPCNNSPAQSFALTG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgccccacacccgtcccctgcgtctcagagcacgcgcgacaggcgccgcgctcgtcgtg
accgtcgccggactcggcgtcaacgccaccgtcaccaccgcccgggccgccgacccggtc
gcccaggtctgggtcaccaccgccgacggcagcaagaagctcaccgccgagggaagcgtc
ccgttcaccggcgccccgcagggcgtcgacatccgtatcgacgccaacagcaagggccag
aagttcaccggtgcgggcgcctccgtcaccggcgcctccgcccatctcgtccagggcctc
ccccaggcacagcgcacctcgctgctgaggtcgctgttctcctcggagggggacggcatc
gggctcaactacctgcgccagcccctgggcagcaccgacttcgacgccaacgcgaacgcg
tacacctacgaggacacccggggctccttctccatcgaccgggaccggggccagatcatc
ccggtcctgaagcaggccaccgcgatcaaccccgcgatccgcttcatgggctccccgtgg
tctcccccggcctggatgaagaccaacaactccctcaacgggggcagcctcaggaccgag
cactaccaggcgtacgccgactatctggtcaaggcgatcagggcgtacgggcaggagggc
atcaccctcacggacctcaccgcgcagaacgagcccgagttcgccaccagttacccctcc
atgagcatgaccgcggcccagcaggcggacttcttccaggtcctcgaccgcacgctgacc
gccgcgaacctgcccaccaacctcctggcctacgaccacaactgggaccaccccaactac
ccgctggacgtcttcgccaggacgggtggcatccagcggatcatcggcgcggccttccac
tgctacggcggggccgtgggggcgcagcagcagatcgtcaacgccgggaagcgcgtcttc
ttcaccgagtgctccggcaccgacagcacgaaccccgccacgacgttcggcgacaccctc
aagtggcacaccgagaacctcgtcgtacagaacatgcgcaacggcggcgagacggtcgtc
aactggaacctggccctggaccggaacggcggcccccaccaggggcactgcaccaaccgc
tgcaacggcatcgtcgagatcgacggcggccaggtcacccggaacgcggagtactacgtc
ctcgggcacgtcaccaagttcatcaggcccggcgcgacccgtatcggctccacgagccag
ggcgccgggggcgtgcagaacgtcgccttccagaacaccgacggcagccgggccgccgtc
gtcgtcaacaccgcatcgaactcccagcggttctcgctgaccgacaacgggaagtccctc
gccttcaccctgccggccggtgcggtcgccacgttcacctgggacgggagcggtgggacg
accgagcctcccgtgggttcgatcgaccccgccgcctggtaccgggtgcagaacaccaac
agcggggcctgcctggacgccgccgactggggcaccggtgacggcaccgcgctccagcag
tgggcctgcgggaccggggccaaccagggctggcagttccggccggccgacggtggccac
taccaggtggtgaaccggcacaacgcgaaggtctgggacgtggacggcggcgccggggcg
accgccgacggcaccaaggtccacctctggtcctccgtgggttccaccaaccagcagtgg
cggcccgagcccctggccaccagcggccggtaccgcttcgtcgcccgccacagcggcaag
tgcctcaccgtcgacggctcctccacggcgaacggggcgaagctgtcccagcagccgtgc
aacaactcccccgcccagtcgttcgctctgaccggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system