KEGG   Streptomyces fulvissimus: SFUL_2753Help
Entry
SFUL_2753         CDS       T02650                                 

Definition
fatty acid desaturase (membrane) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sfi  Streptomyces fulvissimus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SFUL_2753
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SFUL_2753
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SFUL_2753
Lipid biosynthesis proteins [BR:sfi01004]
 Desaturase
  First
   SFUL_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3133511..3134512
Genome map
AA seq 333 aa AA seqDB search
MPSTPDVIDESGPSAAGATPTATATLPPATLGGEKKRSIEQFALLAFIVVPFVALLAAVP
LVWGWGVSWLDVGLMVAMYFIGCHGITIGFHRYFTHGSFKAKRPLRIALAVMGSLAVEGP
LVRWVADHRKHHRFSDAEGDPHSPWRFGETLPALMKGLWWAHIAWMFDEEQTPQQKYAPD
LIRDPAIRGISRHFLSFTIVSLAIPPLVGGLVTMSWWGAATAFFWGSLVRVALLHHVTWS
INSICHAVGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVMRGQIDSSARL
IRWFEQLGWASDVRWPDAARIDARRTPVPADPA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccacgcccgacgtgatcgacgagtccggcccatccgccgccggcgcgacccct
accgccaccgccactcttccgcccgcgacgctcggcggggaaaagaagaggtcgatcgag
cagttcgcgctgctggcgttcatcgtggtgccgttcgtggccctgctggcggcggtgccg
ctggtgtgggggtggggggtgagctggctggacgtggggctgatggtggcgatgtacttc
atcggctgccacggcatcacgatcggcttccaccggtacttcacgcacggttcgttcaag
gcgaagcgaccgctgcggatcgcgctggccgtgatgggttcgctggcggtggaggggccc
ctggtgcggtgggtggccgatcaccgcaagcaccacaggttctcggacgcggagggtgac
ccgcattcgccgtggcggttcggggagaccctgccggcgctgatgaagggcctgtggtgg
gcgcacatcgcatggatgttcgacgaggaacagactccgcagcagaagtacgcccccgat
ctgatcagggacccggcgatccggggtatctcgcgccacttcctctccttcacgatcgtc
tcgctggcgattccgccgctggtgggcggtctggtgacgatgtcgtggtggggtgcggcg
acggccttcttctggggttcgctggtgcgggtcgcgctgctgcaccacgtgacgtggtcg
atcaactcgatctgccacgcggtcggcaagcgtcccttcaagtcccgtgaccgttcgggg
aacgtgtggtggctggcggtgctgtcgtgcggcgagtcgtggcacaacctgcaccacgcg
gacccgacgagtgcgcggcacggggtgatgcgggggcagatcgactccagtgcccggctg
atccgctggttcgagcagctggggtgggcgtccgacgtgcggtggccggacgctgcccgt
atcgacgcccggcgcacgcccgtaccggccgacccggcatga

DBGET integrated database retrieval system