KEGG   Streptomyces fulvissimus: SFUL_2907Help
Entry
SFUL_2907         CDS       T02650                                 

Definition
Pectinesterase Precursor (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sfi  Streptomyces fulvissimus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SFUL_2907
   00500 Starch and sucrose metabolism
    SFUL_2907
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SFUL_2907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3303815..3304909)
Genome map
AA seq 364 aa AA seqDB search
MPSRRTALALFAGTTAALTLGAPAVHAGPARLRPFGRYGSPARRLDPRTLYVDGHGRGDH
TDVQSAVDAVTGTGHTLVIAPGVYRATVLIGPAHEGLTLIGASNDARDTVLVYDNAAGTP
KPDGSGTLGTSGSASVTVRAAGFTARDLTFANDWLRSDNPAYTGTQAVAIKVQGDRSAFY
GCRFLGHQDTLYADSLAVTAAARQYYRDCFMEGDVDFVFGRATAVFDRCHFRTLTRTDLA
SAPYGYVFAPSTAGANPYGFLVLRSRVTSAAPDAYYKLARPWVPSSDLTARPMLTVRDSR
LGPGIDAVTPYATMSAGFPWQDQRFAEHRNTGPGARVTVPADRPQLTAAEARAHTPARWL
SDAR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaggcgcaccgctctcgccctgttcgccggaaccaccgccgccctcaccctc
ggcgcgcccgccgtccacgccggtcccgcgcgcctccgtcccttcggccgttacggctca
cccgcccgacggctggacccccgcacgctgtacgtcgacgggcacggccggggcgaccac
accgacgtacagtccgccgtcgacgcggtgaccggcaccgggcacaccctcgtgatcgcc
cccggcgtgtaccgggcgaccgtgctcatcggccccgcccacgaggggctcaccctgatc
ggcgcgagcaacgacgcccgggacaccgtgctcgtgtacgacaacgcggcgggcacgccg
aagcccgatggctccgggaccctgggcaccagcggatcggcctccgtcacggtccgggcg
gccgggttcacggcccgcgacctgaccttcgccaacgactggctgcgctcggacaacccc
gcgtacaccggcacgcaggccgtcgccatcaaggtccagggcgaccggtcggcgttctac
ggctgccggttcctcggtcaccaggacaccctgtacgccgactccctcgccgtcaccgca
gctgcccgccagtactaccgcgactgcttcatggagggggacgtcgacttcgtcttcggt
cgcgccaccgccgtcttcgaccgctgccacttccgtacgctcacccgcaccgacctggcc
tcggccccgtacggctacgtcttcgcgccgagcacggccggggccaacccgtacggcttc
ctggtcctgcgctcccgggtcacgagcgccgcccccgacgcgtactacaagctcgcccgc
ccctgggtgccctcgtcggacctcaccgcgcgcccgatgctgaccgtccgggacagccgg
ctcgggccggggatcgacgcggtgacgccgtacgccaccatgtccgcgggcttcccctgg
caggaccagcgcttcgccgagcaccgcaacaccggccccggcgcccgtgtcaccgtcccc
gccgaccgaccgcagctcaccgccgccgaggcccgcgcccacactccggcccgctggctg
tccgacgcccgctga

DBGET integrated database retrieval system