KEGG   Streptomyces fulvissimus: SFUL_4622Help
Entry
SFUL_4622         CDS       T02650                                 

Definition
(GenBank) MDH Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00020  Citrate cycle (TCA cycle)
sfi00270  Cysteine and methionine metabolism
sfi00620  Pyruvate metabolism
sfi00630  Glyoxylate and dicarboxylate metabolism
sfi00680  Methane metabolism
sfi01100  Metabolic pathways
sfi01110  Biosynthesis of secondary metabolites
sfi01120  Microbial metabolism in diverse environments
sfi01130  Biosynthesis of antibiotics
sfi01200  Carbon metabolism
Module
sfi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sfi_M00012  Glyoxylate cycle
sfi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SFUL_4622
   00620 Pyruvate metabolism
    SFUL_4622
   00630 Glyoxylate and dicarboxylate metabolism
    SFUL_4622
  Energy metabolism
   00680 Methane metabolism
    SFUL_4622
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SFUL_4622
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SFUL_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Stealth_CR1
Motif
Other DBs
NCBI-ProteinID: AGK79518
UniProt: N0D132
Position
5089299..5090288
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGHLLGPDVPVNLRLLEIPQGLKAAEGTAMELDD
CAFPLLRGIEITDDPNVGFAGANVALLVGARPRTKGMERGDLLAANGGIFKPQGKAINDN
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRAISQLAAKTGAAVSDIK
KLTIWGNHSATQYPDIFHAEIAGKNAAEVVNDEVWLGDTFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYTWVNGTAEGDWTSMGIPSDGSYGVPEGIISSFPVTTKDGKYEIVQGLD
INEFSRTRIDASVKELTEERDAVRELGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaatgtcaccgtgaccggcgctgccggccagatcggctacgcg
ctgctcttccgcatcgcctccggccacctgctcggcccggacgtgccggtcaacctgcgc
ctcctggagatcccgcagggcctcaaggccgccgagggcaccgcgatggagctcgacgac
tgcgccttcccgctgctgcggggcatcgagatcaccgacgacccgaacgtcggcttcgcc
ggggcgaacgtggccctgctcgtcggcgcccgcccgcgtaccaagggcatggagcgcggc
gacctgctcgccgccaacggcggcatcttcaagccgcagggcaaggccatcaacgacaac
gccgcggacgacatcaaggtcctcgtcgtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgccccggacgtaccggccgagcgcttcaccgcgatgacccgcctggac
cacaaccgcgcgatctcgcagctggccgccaagaccggtgccgccgtctccgacatcaag
aagctgacgatctggggcaaccactcggccacccagtacccggacatcttccacgcggag
atcgccggcaagaacgccgccgaggtcgtcaacgacgaggtatggctgggcgacaccttc
atcccgaccgtcgccaagcgcggcgcggcgatcatcgaggcccgtggcgcgtcctcggcc
gcctcggccgccaacgccgccatcgaccacgtgtacacctgggtcaacggcaccgccgag
ggcgactggacctcgatgggtatcccgtcggacggctcctacggcgttcccgagggcatc
atctcctccttcccggtcaccacgaaggacgggaagtacgagatcgtccagggcctggac
atcaacgagttctcccgtacgcgcatcgacgcgtcggtcaaggagctcaccgaggagcgc
gacgcggtccgcgagctcggcctcatctga

DBGET integrated database retrieval system