KEGG   Streptomyces fulvissimus: SFUL_4622Help
Entry
SFUL_4622         CDS       T02650                                 

Definition
MDH Malate dehydrogenase (EC:1.1.1.37)
Orthology
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
sfi  Streptomyces fulvissimus
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SFUL_4622
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SFUL_4622
   00620 Pyruvate metabolism
    SFUL_4622
   00630 Glyoxylate and dicarboxylate metabolism
    SFUL_4622
  Energy metabolism
   00680 Methane metabolism
    SFUL_4622
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SFUL_4622
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     SFUL_4622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5089299..5090288
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGHLLGPDVPVNLRLLEIPQGLKAAEGTAMELDD
CAFPLLRGIEITDDPNVGFAGANVALLVGARPRTKGMERGDLLAANGGIFKPQGKAINDN
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRAISQLAAKTGAAVSDIK
KLTIWGNHSATQYPDIFHAEIAGKNAAEVVNDEVWLGDTFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYTWVNGTAEGDWTSMGIPSDGSYGVPEGIISSFPVTTKDGKYEIVQGLD
INEFSRTRIDASVKELTEERDAVRELGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaatgtcaccgtgaccggcgctgccggccagatcggctacgcg
ctgctcttccgcatcgcctccggccacctgctcggcccggacgtgccggtcaacctgcgc
ctcctggagatcccgcagggcctcaaggccgccgagggcaccgcgatggagctcgacgac
tgcgccttcccgctgctgcggggcatcgagatcaccgacgacccgaacgtcggcttcgcc
ggggcgaacgtggccctgctcgtcggcgcccgcccgcgtaccaagggcatggagcgcggc
gacctgctcgccgccaacggcggcatcttcaagccgcagggcaaggccatcaacgacaac
gccgcggacgacatcaaggtcctcgtcgtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgccccggacgtaccggccgagcgcttcaccgcgatgacccgcctggac
cacaaccgcgcgatctcgcagctggccgccaagaccggtgccgccgtctccgacatcaag
aagctgacgatctggggcaaccactcggccacccagtacccggacatcttccacgcggag
atcgccggcaagaacgccgccgaggtcgtcaacgacgaggtatggctgggcgacaccttc
atcccgaccgtcgccaagcgcggcgcggcgatcatcgaggcccgtggcgcgtcctcggcc
gcctcggccgccaacgccgccatcgaccacgtgtacacctgggtcaacggcaccgccgag
ggcgactggacctcgatgggtatcccgtcggacggctcctacggcgttcccgagggcatc
atctcctccttcccggtcaccacgaaggacgggaagtacgagatcgtccagggcctggac
atcaacgagttctcccgtacgcgcatcgacgcgtcggtcaaggagctcaccgaggagcgc
gacgcggtccgcgagctcggcctcatctga

DBGET integrated database retrieval system