KEGG   Streptomyces fulvissimus: SFUL_4694Help
Entry
SFUL_4694         CDS       T02650                                 

Definition
Thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sfi  Streptomyces fulvissimus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SFUL_4694
Enzymes [BR:sfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SFUL_4694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5192816..5194093
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRTKRDRGELTPEQIDWVIDAYTRGEVADEQMSALAMAILLNGMNRTEIARWTA
AMIASGERMNFSALSRPTTDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRAHISNEEMLNVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGALVLDVKVGSGAFMKTIEDARELASTMVALGTDSGVRTVALLTDMS
TPLGLTAGNALEVRESVEVLAGGGPQDVIDLTLALAREMLDAAGLKDADPEKALADGSAM
DVWRRMISAQGGDPDATLPVAREQHVVTARSSGVLTRLDAYDVGVAAWRLGAGRARKEDP
VQAGAGVELHAKPGDTVTEGQPLMTLHTDTPEKFDYALKALPDAYDVAPAGTSYAALPVV
RERIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcaccaagcgggaccgaggcgagctgacccccgagcag
atcgactgggtcatcgacgcgtacacccgcggcgaggtcgccgacgagcagatgtccgcc
ctcgccatggcgatcctgctcaacggcatgaaccgcaccgagatcgcccgctggaccgcc
gcgatgatcgcctccggcgagcggatgaacttctccgcgctctcccgccccaccaccgac
aagcactccaccggcggcgtcggcgacaagatcaccctgccgctcgccccgctggtcgcc
gcgtgcggcgcggccgtgccgcagctcagcggccggggcctcggccacaccggcgggacc
ctggacaagctggagtccatccccggctggcgggcccacatctccaacgaggagatgctg
aacgtcctggacaccaccggcgcggtcatctgcgccgccggtgacggcctcgcccccgcc
gacaagaagctgtacgcgctgcgcgatgtcaccggcaccgtcgaggcgatcccgctcatc
gccagctcgatcatgtccaagaagatcgccgagggcaccggcgcgctcgtcctggacgtc
aaggtcggctccggcgccttcatgaagaccatcgaggacgcccgcgaactggcctccacc
atggtcgcgctcggcaccgacagcggcgtgcggacggtcgccctgctcaccgacatgtcg
accccgctcggcctcaccgcgggcaacgccctggaggtccgcgagtcggtcgaggtcctc
gccggtggcggcccgcaggacgtcatcgacctgaccctcgccctcgcccgcgagatgctc
gacgcggccggcctgaaggacgccgaccccgagaaggcgctcgccgacggctccgccatg
gacgtctggcgccggatgatctccgcccagggcggcgacccggacgccacgctcccggtc
gcccgcgagcagcacgtggtcaccgcgcgctcctccggcgtcctgacccgcctggacgcc
tacgacgtcggcgtcgccgcctggcgcctcggcgcgggccgcgcccgcaaggaggacccg
gtgcaggcgggcgcgggcgtcgaactccacgccaagcccggcgacaccgtcaccgagggc
cagcccctgatgacgctgcacacggacaccccggagaagttcgactacgcgctgaaggcc
ctgccggacgcgtacgacgtcgccccggccggcacgtcgtacgcggcgctcccggtggtg
cgggaacgtatcgcgtaa

DBGET integrated database retrieval system