KEGG   Streptomyces fulvissimus: SFUL_5209Help
Entry
SFUL_5209         CDS       T02650                                 

Definition
Endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sfi  Streptomyces fulvissimus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SFUL_5209
Enzymes [BR:sfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SFUL_5209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5754751..5755791)
Genome map
AA seq 346 aa AA seqDB search
MSGRRTIRRVFGVLPALASVALAAALTAGCSAPGGATPTAAEADPVRGEPAPSAASPYWV
DPNSDAARQVRAWDRQGREEDAKALRRIADRPVALWPAWDGPAPEIRAAAKAASGTEKNV
LLVAYNIPHRDCGLYSAGGAKDADAYRTWIGEFADAIGDAPATVILEPDALPHIADGCTP
PEHHAERYQLLSEAVDTLKAKPRTKVYLDAGNPDWIVEPYKIAEPLRLAGIDRADGFSLN
VSNFQSNASVKEYGALLSDSVGGAHYVIDTSRNGGGPLTGGRAEAWCNPPGRALGTPPTT
DTRDDRLDAYLWIKRPGESDGTCRGGPEAGTWWPEYALGLARRAKS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccgcagaaccatccgcagagtcttcggcgttctccccgccctggcctccgtc
gccctggcggccgccctcacggcgggctgctccgccccgggcggcgcgactcccacggcc
gccgaggccgaccccgtacgcggcgaacccgcgccgagcgcggcgtccccgtactgggtg
gaccccaacagcgacgcggcccgccaggtgcgcgcctgggaccggcagggccgcgaggag
gacgcgaaggcgctgcggcggatcgccgaccggccggtggcgctctggcccgcctgggac
ggtccggcgccggagatccgggccgccgcgaaggcagcgtccgggacggagaagaacgtc
ctgctcgtcgcgtacaacattccgcaccgcgactgcgggctctactccgcgggcggggcc
aaggacgcggacgcctaccggacctggatcggggagttcgccgacgccatcggcgacgcc
ccggcgaccgtgatcctggagcccgacgcgctcccccacatcgcggacggctgcaccccg
cccgagcaccacgccgagcgctaccagctgctctccgaggccgtggacacgctgaaggcc
aagccgcggaccaaggtctacctggacgcgggcaacccggactggatcgtggaaccgtac
aagatcgcggagccgctgcggctggccgggatcgaccgggccgacggcttctcgctgaac
gtctccaacttccagtcgaacgcgagtgtcaaggagtacggggccctcctctccgactcc
gtcggcggcgcgcactacgtgatcgacaccagccgcaacggcggcggcccgctgaccgga
ggccgcgccgaggcctggtgcaacccgccgggcagggcgctcggcacgccgccgaccacc
gacacccgcgacgaccggctcgacgcctacctgtggatcaagcggcccggcgagtcggac
ggcacctgccggggagggcccgaggcgggcacctggtggccggagtacgccctggggctg
gcccggcgcgccaagtcctga

DBGET integrated database retrieval system