KEGG   Streptomyces fulvissimus: SFUL_5280Help
Entry
SFUL_5280         CDS       T02650                                 

Definition
(GenBank) Amine oxidase, flavin-containing
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sfi  Streptomyces fulvissimus
Pathway
sfi00860  Porphyrin and chlorophyll metabolism
sfi01100  Metabolic pathways
sfi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SFUL_5280
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SFUL_5280
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SFUL_5280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_oxidored Pyr_redox FAD_binding_2 NAD_binding_9 FAD_binding_3 HI0933_like AlaDh_PNT_C Lycopene_cycl F420_oxidored GIDA Pyr_redox_3 NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGK80173
UniProt: N0D2S7
Position
5850726..5852078
Genome map
AA seq 450 aa AA seqDB search
MLMSARTRTAVIGGGMAGSAAARKLVRAGREVVVLEAADGLGGRARSWHRPEIDPDVGIN
LMYVSFYRLMTELIEEYGLRDDLIKISSNVYISDDGAPRALSSDSPLSLLTYGHVSFLDR
IRFLLTTLKQVRRKNELDLFDPVKSAPFDDGLSAADWGYRQVSKRGFDFLLRPQIEGFWN
FACEDASAVHARALLAWMGGSGFYVLRNGMETIAERNTEGAEVRLSHEVTDVRTDGDGVR
ITAVREGGEQVVETFDEVVVATPATIAAKLVAALPDRTVSHHTRAFLESQEYEPALSVSY
LVDADALPAEAHIVAGGPEDPPLRNMITYPRTVRDAQGRAVDKLLVFTYPGRANTRRLIG
LTPEEQFAEVTPLLKTLWPTFPTASAEPFQIAERPYGFPIPAPGRYARSVQVLAEQRAPV
VFAGDYFNSPTTEAALLSGYRAAETLTGTG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgtccgctcgcaccaggaccgcggttatcggcggtggcatggccggcagcgcc
gccgcccgcaaactcgtccgggccggccgggaggtcgtggtcctggaggccgcggacggg
ctcggcggccgggcccggtcgtggcaccggccggagatcgatcccgacgtcgggatcaat
ctgatgtacgtcagcttctaccggctgatgacggagctcatcgaggagtacggcctcagg
gacgacctgatcaagatctccagcaacgtctacatatccgacgacggcgccccccgcgcc
ctctcgtcggactctcccctcagcctgctcacctacgggcacgtctccttcctggaccgg
atccgcttcctgctcaccacgttgaagcaggtccgccgcaagaacgagctcgacctcttc
gacccggtcaagtccgccccgttcgacgacgggctctccgcggcggactggggataccgc
caggtctccaagcgcggcttcgacttcctgctccgcccgcagatcgaggggttctggaac
ttcgcctgcgaggacgcctccgccgtgcacgcccgggccctgctggcctggatgggcggg
tccggcttctacgtcctgcgcaacggcatggagaccatcgccgagcggaacaccgagggc
gccgaggtgcgcctgtcgcacgaggtcaccgatgtccggaccgacggggacggagtgcgg
atcacggcggtccgggagggcggcgaacaggtcgtcgaaacgttcgacgaggtcgtcgtc
gccacccccgcgacgatcgccgcgaaactggtggcggcactgcccgaccggaccgtgagc
catcacacgcgggccttcctggagtcccaggagtacgaaccggccctctccgtctcgtac
ctggtcgacgccgacgcgctgcccgccgaagcgcacatcgtggccgggggccccgaggac
ccgccgctgcggaacatgatcacctacccccgcacggtacgggacgcgcagggccgggcc
gtcgacaagctgctggtcttcacctaccccggacgggccaacacccgccggctcatcggt
ctcacccccgaggagcagttcgccgaggtcaccccgctgctgaagacgctctggcccacc
ttcccgaccgcgagcgccgaacccttccagatcgccgagcggccctacgggttccccatc
cccgccccgggccgctacgcgcgctccgtccaggtcctggcggagcagcgggccccggtc
gtcttcgcgggtgactacttcaactcgcccaccacggaagcggcgctgctctccggctac
cgggccgccgagacgctgaccggcacaggctga

DBGET integrated database retrieval system