KEGG   Streptomyces fulvissimus: SFUL_5282Help
Entry
SFUL_5282         CDS       T02650                                 

Definition
NDP-hexose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sfi  Streptomyces fulvissimus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SFUL_5282
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SFUL_5282
Enzymes [BR:sfi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SFUL_5282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5853303..5853881
Genome map
AA seq 192 aa AA seqDB search
MRIEETGIPGAFAVTPHLLPDDRGSFHEGMRADKLEQVLGAPFVPRQISYSVSVRDTLRG
IHTTAVPPGQAKYVTCVHGALRDIIVDLRVGSPAFGRHHVCTLDARSGRSLYIPEGVGHG
FLALADDTRICYVMSTVYAPGTQIDIDPFDPRLDLPWGLTAAPRMSKKDTEARSLAETLE
AGLLPAWQGTGV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcgaggagacgggaatccccggcgccttcgccgtcaccccgcacctgctgccc
gacgaccgcggcagcttccacgaggggatgcgcgcggacaagctggagcaggtcctcggc
gcccccttcgtcccccggcagatcagttactcggtctccgtccgggacaccctgcgcggc
atccacaccaccgccgtgcccccggggcaggccaagtacgtcacctgcgtccacggtgcg
ctgcgggacatcatcgtggacctgagagtgggctcgcccgccttcggccggcaccacgtc
tgcacgctcgacgcgcgctccggacgctccctctacatccccgagggcgtcgggcacggc
ttcctggcgctggccgacgacacccggatctgttacgtgatgtcgacggtgtacgcaccg
ggcacccagatcgacatcgacccgttcgacccccggctcgacctgccctgggggctgacc
gcggcgccccggatgtcgaagaaggacaccgaggcccgcagcctggccgagacgctggaa
gccggactgctgccggcctggcagggaacgggagtgtga

DBGET integrated database retrieval system