KEGG   Streptomyces fulvissimus: SFUL_5282Help
Entry
SFUL_5282         CDS       T02650                                 

Definition
(GenBank) Putative NDP-hexose 3,5-epimerase
  KO
K13316  
NDP-hexose 3,5-(Or5-) epimerasee
Organism
sfi  Streptomyces fulvissimus
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SFUL_5282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5853303..5853881
Genome map
AA seq 192 aa AA seqDB search
MRIEETGIPGAFAVTPHLLPDDRGSFHEGMRADKLEQVLGAPFVPRQISYSVSVRDTLRG
IHTTAVPPGQAKYVTCVHGALRDIIVDLRVGSPAFGRHHVCTLDARSGRSLYIPEGVGHG
FLALADDTRICYVMSTVYAPGTQIDIDPFDPRLDLPWGLTAAPRMSKKDTEARSLAETLE
AGLLPAWQGTGV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcgaggagacgggaatccccggcgccttcgccgtcaccccgcacctgctgccc
gacgaccgcggcagcttccacgaggggatgcgcgcggacaagctggagcaggtcctcggc
gcccccttcgtcccccggcagatcagttactcggtctccgtccgggacaccctgcgcggc
atccacaccaccgccgtgcccccggggcaggccaagtacgtcacctgcgtccacggtgcg
ctgcgggacatcatcgtggacctgagagtgggctcgcccgccttcggccggcaccacgtc
tgcacgctcgacgcgcgctccggacgctccctctacatccccgagggcgtcgggcacggc
ttcctggcgctggccgacgacacccggatctgttacgtgatgtcgacggtgtacgcaccg
ggcacccagatcgacatcgacccgttcgacccccggctcgacctgccctgggggctgacc
gcggcgccccggatgtcgaagaaggacaccgaggcccgcagcctggccgagacgctggaa
gccggactgctgccggcctggcagggaacgggagtgtga

DBGET integrated database retrieval system