KEGG   Streptomyces fulvissimus: SFUL_5758Help
Entry
SFUL_5758         CDS       T02650                                 

Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sfi  Streptomyces fulvissimus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sfi00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6379491..6380144
Genome map
AA seq 217 aa AA seqDB search
MPELVFFSGTMDCGKSTLALQIGHNRSARGLQGVIFTRDDRAGQGKLSSRLGLVTDAVEA
DEGMDVYGHIVDRVSRGGRVDYVIVDEAQFLAPVQIDQLARVVDDLGLDVFAFGITTDFR
TKLFPGSQRLIELADRIEALQVEALCWCGARATHNARTVDGEMVVEGAQVVVGDVNRQAG
EVGYEVLCRRHHRRRLTAETARAGTLSPDVLPVAAEG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctggtgttcttctccggaaccatggactgcggaaagagcacgctggccctg
cagatcggtcacaaccgttccgcccgcgggctccagggcgtgatcttcacccgcgacgac
cgcgccggccaggggaagctctcctcccggctcggcctggtgacggacgccgtcgaggcg
gacgagggcatggacgtctacgggcacatcgtcgaccgggtcagccggggcggccgggtc
gactacgtgatcgtggacgaggcgcagttcctcgccccggtccagatcgaccagttggcc
cgggtcgtcgacgatctgggcctggacgtcttcgcgttcggcatcaccacggacttccgt
acgaagctgttccccggctcccagcggctgatcgagctggccgaccggatagaggccctc
caggtcgaggcgctctgctggtgcggcgcccgcgccacgcacaacgcccgtacggtggac
ggcgaaatggtggtcgagggcgcccaggtcgtcgtcggcgacgtcaaccggcaggcgggc
gaggtcggttacgaggtgctgtgccgccgccaccaccggcgccggctgaccgcggagacg
gcccgcgcgggcacgctctccccggacgtcctgccggtcgccgccgaaggctga

DBGET integrated database retrieval system