KEGG   Streptomyces fulvissimus: SFUL_5997Help
Entry
SFUL_5997         CDS       T02650                                 

Definition
Protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sfi  Streptomyces fulvissimus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SFUL_5997
Enzymes [BR:sfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SFUL_5997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6706965..6708428
Genome map
AA seq 487 aa AA seqDB search
MQRSHQDADPSVRHAVVIGGGIAGLAAAHRLVATGLRVTLLEATARLGGKLMTGEIAGVQ
VDLGAESMLARRPEAVDLAGAVGLAGRLQPPATATASLWTRDALRPMPKGHVMGVPGDPA
ALGGVLSPEGLARIAEERELTPTPVGDDVAVGAYVADRLGREVVDRLVEPLLGGVYAGDA
YRISMRAAVPQLFEAVKEGGPLLDAVRRIQERAAARQQTGPVFQGIEGGIGTLPDAVADA
VRAGGGAILTETPVLGLTRTEAGWAVRTDTGVITADAVVLATPAWSASALLAADSPAASA
ELAGVEYASMALVTLAFRRSDIEAYEALRGRSGFLVPPVDGRTIKASTFSSNKWQWVADA
APDLFVLRTSVGRYGEEDHLHREDGELVAVSLRDLRAATGLAARPVDSEVTRWIGGLPQY
PVGHHTRVARIRDEVAKLPALRVCGAVYDGVGIPACIASAQRAADEIMKEIIATPTLVQG
TGSEAGQ
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgttcacatcaggatgcggacccgtccgtgcgccatgccgtcgtcatcggcggc
ggtatcgccggactggccgccgcccaccgcctggtcgccaccggcctgcgggtcacgctc
ctggaggcgaccgcccggctcggcggcaagctcatgaccggcgagatcgcgggcgtccag
gtcgacctcggcgcggagtcgatgctcgcccgccgccccgaggcggtcgacctggccggt
gcggtcggcctcgccggccgcctccagccgcccgccaccgccaccgcctccctctggacg
cgcgacgcgctgcgtccgatgcccaagggccatgtcatgggcgtccccggcgacccggcg
gccctcggcggggtgctgtcccccgaaggcctggcccggatcgccgaggagcgcgagctc
accccgacccccgtcggggacgacgtcgccgtcggcgcgtacgtcgccgaccggctcggc
cgcgaggtcgtcgaccgcctggtggaacccctcctcggcggggtctacgcgggcgacgcc
taccggatctcgatgcgggccgccgtaccgcagctcttcgaagcggtgaaggagggcggc
ccgctgctggacgccgtccgccggatccaggagcgcgcggcggcccggcagcagaccgga
cccgtcttccagggcatcgaggggggcatcggcaccctgccggacgccgtggccgacgcc
gtacgggccggcggcggcgcgatcctcaccgagacgcccgtcctcggtctgacccgtacg
gaggcgggctgggcggtccgcaccgacaccggggtgatcaccgccgacgccgtcgtcctg
gccacccccgcctggtccgcctccgccctgctcgccgccgactcgccggccgcctccgcc
gaactggccggcgtcgagtacgcctccatggccctggtcaccctggccttccgccgctcc
gacatcgaggcgtacgaagccctgcgcggccgctccggcttcctcgtaccgccggtcgac
ggccgcaccatcaaggcgtccaccttctccagcaacaagtggcagtgggtcgccgacgcc
gcccccgacctcttcgtgctccgcacctcggtgggccggtacggcgaggaggaccacctg
caccgcgaggacggcgaactcgtcgccgtatccctgcgcgacctccgagccgccacggga
ctggccgcacgccccgtcgacagcgaggtcacccgctggatcggcgggctgccgcagtac
ccggtcggccaccacacccgggtcgcccgcatccgcgacgaggtcgcgaaactgcccgcc
ctgcgggtctgcggcgcggtctacgacggggtcggcatccccgcctgcatcgcgagcgcg
cagcgcgcggccgacgagatcatgaaggagatcatcgccacgcccaccctggttcagggc
accgggagcgaggcgggacaatag

DBGET integrated database retrieval system