KEGG   Streptomyces fulvissimus: SFUL_6132Help
Entry
SFUL_6132         CDS       T02650                                 

Definition
Chitosanase II (EC:3.2.1.132)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sfi  Streptomyces fulvissimus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6865203..6866288)
Genome map
AA seq 361 aa AA seqDB search
MHQRTTPPTEPTPTVGRRRFARKALLAASALGVVTALLAPVRAGAAPAPAAPTAKAATPL
AANGQLSVCGRQLCNASGQAVALNGMSTHGTQWYAQCVTDGSLNALATDWRADVLRVSTY
VQEGGYETDPAGFTARAQKFIDAAHARGMYAVIDWHMLSPGDPNANLARAKTFFTAMAKK
YKDHPGVLYEIANEPSGVSWSAIKSYSEQIIPVIRAQDPDAVVLVGTRAWSSFGVSEGSN
ESEVVNNPVRASNIMYTFHFYAASHREEYLSALDRASDRLPVFVTEFGTQNYAGEGANDF
AMSQRYLDLMKRKKISWTNWNYSDDHRSGAVFKTGTCNGSNWTGTGVLKEAGVWIRDRIR
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagcgcaccactccccccaccgagcccacccccacggtcggccgacgacgattc
gcccgaaaggccctgctcgccgcgtccgcgctcggcgtggtcaccgcactcctggccccc
gtccgggcgggtgccgccccggcccccgccgcccccacggccaaagccgcgacgccgctc
gcggccaacggccagctctccgtctgcggccggcagctctgtaacgcctcaggccaggcc
gtcgccctcaacggcatgagcacccacggcacccagtggtacgcccagtgcgtcaccgac
gggtcgctcaacgccctggccaccgactggcgcgccgatgtgctgcgcgtctccacctac
gtacaggagggcgggtacgagaccgacccggccgggttcaccgcgcgggcgcagaagttc
atcgacgcggcgcacgcgcgcggcatgtacgcggtcatcgactggcacatgctctcgccg
ggcgatcccaacgcgaacctcgcgcgggccaagaccttcttcaccgcgatggcgaagaag
tacaaggaccacccgggcgtgctctacgagatcgccaacgagccctccggggtgagctgg
tcggccatcaagtcctactccgagcagatcattccggtgatccgggcgcaggaccccgac
gcggtggtcctggtcgggacgcgcgcctggtcctcgttcggggtctccgagggctccaac
gagtcggaggtcgtgaacaacccggtccgcgcctcgaacatcatgtacaccttccacttc
tacgcggcctcgcaccgcgaggagtacctcagcgccctggaccgggcctccgaccggctg
cccgtcttcgtcaccgagttcgggacgcagaactacgcgggcgagggcgccaacgacttc
gcgatgtcgcagcgctacctcgatctgatgaagcgcaagaagatctcctggaccaactgg
aactactccgacgaccaccgctccggtgccgtcttcaagaccggtacctgcaacggttcc
aactggacggggaccggggtcctgaaggaggccggggtctggatccgcgaccgcatccgc
cagtga

DBGET integrated database retrieval system