KEGG   Streptomyces fulvissimus: SFUL_6396Help
Entry
SFUL_6396         CDS       T02650                                 

Definition
Carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfi  Streptomyces fulvissimus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SFUL_6396
Enzymes [BR:sfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SFUL_6396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7179868..7180794
Genome map
AA seq 308 aa AA seqDB search
MHDNATGGDRYDLLVVGSANADLVIGVERRPAPGETVLGSDLAVHPGGKGANQAVAAARL
GARTALLARVGDDDHGRLLLESQRAAGVDTGGVLVGGAPTGVALITVDPSGDNSIVVSPG
ANGRLTPEDVTAAAPLLAAARVVSVQLEIPLDTVAETARNLAPGARLVLNPSPPAPLPDE
VLAACDPLVVNEHEARYILGEAAGETPHDWAPALLALGPRSVVITLGPAGALVADSRTGS
LDHLVSPKVEAVDTTGAGDAFTAALAWRLGRGDDLREAAAFAVRVGAAAVTSRGAQASFP
TLEEVDAL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaacgccaccggcggcgaccgttacgacctcctggtcgtaggctcggccaac
gccgacctggtgatcggcgtcgaacgccgccccgcccccggtgagacggtgctcggctcc
gacctggccgtccacccgggcggcaagggcgccaaccaggctgtcgcggcagccaggttg
ggagcccgtacggcgctgctcgcccgggtcggcgacgacgaccacggacggctgctgctg
gagagccagcgcgcggcgggcgtggacaccggcggcgtcctggtcggcggggccccgacc
ggcgtcgcgctgatcaccgtggacccctcgggcgacaacagcatcgtggtgtccccgggc
gccaacggccgcctcacccccgaggacgtgactgcggcggccccgctgctggcagccgcc
cgggtggtctccgtacagctggagatccccctggacacggtcgcggagacggcccgcaac
ctggcccccggcgcccgcctcgtcctcaacccgtccccgcccgccccgctgcccgacgag
gtgctggccgcctgcgacccgctggtggtcaacgagcacgaggcgcgctacatcctcggc
gaggccgcgggcgagaccccgcacgactgggccccggccctgctcgcactgggcccgcgc
tcggtcgtgatcaccctgggtcctgccggcgcgctggtggccgacagccgcacgggctcc
ctggaccacctcgtcagcccgaaggtcgaggccgtcgacaccacgggggccggggacgcg
ttcaccgccgccctggcctggcgcctgggccggggcgacgacctgcgcgaggcggcggcc
ttcgcggtacgggtgggggcggcggccgtcacgtcgaggggcgcccaggcgtccttcccg
acgctggaggaggtcgacgcgctgtga

DBGET integrated database retrieval system