KEGG   Streptomyces fulvissimus: SFUL_6423Help
Entry
SFUL_6423         CDS       T02650                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sfi  Streptomyces fulvissimus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sfi00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sfi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7214624..7215874
Genome map
AA seq 416 aa AA seqDB search
MISHDTEQIGVPGLWPRLPTAGEGGRTTMTERFTPTPEDKFSFGLWTVGWQGRDPFGDAT
RAAIDPVESVQRLAELGAWGVTFHDDDLIPFGSTDTEREAVVKRFRQAVDASGLVVPMVT
TNLFTHPVFKDGGFTANDRDVRRYALRKTLRNIDLAVELGATTFVAWGGREGAESGGAKD
VRLALHRMKEAFDLLGEYVTEQGYDLRFAIEPKPNEPRGDILLPTIGHALAFIERLERPE
LVGVNPETGHEQMAGLNFPHGIAQAMWADKLFHIDLNGQSGIKYDQDLRFGAGDLRQAFW
LVDLLESGYEGPRHFDFKPPRTEDYDGVWASAAGCMRNYLILKERAAAFRADPEVRAALR
ASRLDELARPTAGDGLAGLLADRTAYEEFDVDAAAERGMAFEALDQLAMDHLLAVR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgattagtcatgacactgaacaaataggggtgccgggcctgtggccccggctcccgacg
gcaggcgaaggcggtcggacgacgatgacggaacgcttcacccccacccccgaggacaag
ttcagcttcggcctgtggactgtgggctggcagggccgggaccccttcggcgacgccacg
cgcgctgccatcgaccccgtcgagtccgtacagcggctcgccgagctgggcgcctggggc
gtgaccttccacgacgacgacctgatccccttcggctcgaccgacaccgagcgcgaggcc
gtcgtcaagcggttccggcaggcggtcgacgccagcggtctcgtcgtccccatggtcacg
acgaacctcttcacccacccggtcttcaaggacggcgggttcaccgccaacgaccgggac
gtacgccgttacgcgctccgcaagaccctgcgcaacatcgacctcgccgtcgagctcggc
gccaccaccttcgtcgcctggggcggccgcgagggggcggagtccggcggggccaaggac
gtacgcctcgccctgcaccggatgaaggaggccttcgacctgctgggggagtacgtcacc
gagcagggttacgacctccgcttcgccatcgagcccaagccgaacgagccgcgcggcgac
atcctgctgcccaccatcggccacgcactcgccttcatcgagcggctggagcgccccgaa
ctggtcggcgtgaacccggagaccgggcacgagcagatggccgggctcaacttcccgcac
ggcatcgcccaggcgatgtgggcggacaagctcttccacatcgacctcaacggccagtcc
ggcatcaagtacgaccaggacctccgcttcggcgccggcgacctgcgccaggcgttctgg
ctcgtcgacctgctggagagcggctacgagggcccgcgccacttcgacttcaagcccccg
cgcaccgaggactacgacggtgtctgggcctcggcggccggctgcatgcgcaactacctg
atcctcaaggagcgcgcagcggccttccgtgccgaccccgaggtgcgggcggcgctccgg
gcctcccgcctggacgaactggcgcgccccaccgccggggacggcctcgcgggactgctc
gccgaccgcacggcgtacgaggagttcgacgtggacgccgccgccgagcgcgggatggcc
ttcgaggccctggaccagctggccatggaccacctgctcgcggtgcgctga

DBGET integrated database retrieval system