KEGG   Streptomyces fulvissimus: SFUL_6473Help
Entry
SFUL_6473         CDS       T02650                                 

Definition
ATP dependent DNA ligase
Organism
sfi  Streptomyces fulvissimus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7263672..7264757)
Genome map
AA seq 361 aa AA seqDB search
MAGQNRAMDLPVMPPVKPMLAKSVSKIPPGMSYEAKWDGFRAIVYRDGDEVEIGSRTGKS
LTRYFPEMVDAVRENLPPRCVIDGELVIAYDGRLDFDRLSERIHPADSRVRMLAERTPAS
LIAFDILAVDDTSLLSTPQVDRRAVLTAALSGASAPVLLAPSTTDIEVAQEWFERYEGAG
LDGIVAKPLDLPYRPDTRVMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDTGGVLQ
HVGVCAAFPMRRRAELAEELAPLRCEFADHPWGAWADAAAHEASRLPGTQNRWSGKKDQS
WVPLRPERVCEVAYDHMEGDRFRHTTQFRRWRPDRDPAGCTYAQLEEVVSYDLAEVLSGG
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggccagaatcgggccatggacctgccggtgatgccgcccgtgaagccgatgctc
gccaagtcggtgtccaagatcccgccgggcatgagttacgaggcgaagtgggacggcttc
cgcgcgatcgtctaccgggacggcgacgaggtcgagatcggcagccgtacgggcaagtcg
ctgacccgctacttccccgagatggtcgacgccgtacgggagaacctgccgccgcgctgc
gtgatcgacggcgagctcgtcatcgcgtacgacgggcggctcgacttcgaccggctcagc
gagcgcatccatccggcggactcccgggtgcggatgctcgccgagcggaccccggcgagc
ctcatcgccttcgacatcctcgcggtagacgacacctcgctcctgagcaccccgcaggtg
gaccggcgggcggtgctgacggccgccctctccggcgcctccgcgcccgtactcctcgcc
ccgtccaccacggacatcgaggtcgcccaggagtggttcgagcggtacgagggcgcgggg
ctcgacgggatcgtggccaagccgctggatctgccgtaccggcccgacacccgggtgatg
tacaagatcaagcacgagcggaccgccgacgtcgtggtggcggggtaccgggagcacaag
agcggcccggtcgtcggctcgctcctgctcggcctgtacgacaccgggggcgtgctccag
cacgtcggggtctgcgcggccttccccatgaggcggcgcgccgagctggccgaggaactc
gccccgctgcggtgcgagttcgccgaccacccgtggggggcgtgggcggacgcggcggcg
cacgaggcctcccggctgccggggacgcagaaccgctggtccggcaagaaggaccagtcg
tgggtgccgctgcggccggagcgggtctgcgaggtggcgtacgaccacatggagggcgac
cggttccgccatacgacacagttccggcggtggcgcccggaccgggacccggccggctgc
acgtacgcgcagctggaggaggtcgtctcctacgacctggccgaggtgctgtcggggggc
ggctga

DBGET integrated database retrieval system