KEGG   Streptomyces fulvissimus: SFUL_6473Help
Entry
SFUL_6473         CDS       T02650                                 

Definition
ATP dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
sfi  Streptomyces fulvissimus
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SFUL_6473
   03420 Nucleotide excision repair
    SFUL_6473
   03430 Mismatch repair
    SFUL_6473
   03450 Non-homologous end-joining
    SFUL_6473
Enzymes [BR:sfi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SFUL_6473
DNA repair and recombination proteins [BR:sfi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SFUL_6473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7263672..7264757)
Genome map
AA seq 361 aa AA seqDB search
MAGQNRAMDLPVMPPVKPMLAKSVSKIPPGMSYEAKWDGFRAIVYRDGDEVEIGSRTGKS
LTRYFPEMVDAVRENLPPRCVIDGELVIAYDGRLDFDRLSERIHPADSRVRMLAERTPAS
LIAFDILAVDDTSLLSTPQVDRRAVLTAALSGASAPVLLAPSTTDIEVAQEWFERYEGAG
LDGIVAKPLDLPYRPDTRVMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDTGGVLQ
HVGVCAAFPMRRRAELAEELAPLRCEFADHPWGAWADAAAHEASRLPGTQNRWSGKKDQS
WVPLRPERVCEVAYDHMEGDRFRHTTQFRRWRPDRDPAGCTYAQLEEVVSYDLAEVLSGG
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggccagaatcgggccatggacctgccggtgatgccgcccgtgaagccgatgctc
gccaagtcggtgtccaagatcccgccgggcatgagttacgaggcgaagtgggacggcttc
cgcgcgatcgtctaccgggacggcgacgaggtcgagatcggcagccgtacgggcaagtcg
ctgacccgctacttccccgagatggtcgacgccgtacgggagaacctgccgccgcgctgc
gtgatcgacggcgagctcgtcatcgcgtacgacgggcggctcgacttcgaccggctcagc
gagcgcatccatccggcggactcccgggtgcggatgctcgccgagcggaccccggcgagc
ctcatcgccttcgacatcctcgcggtagacgacacctcgctcctgagcaccccgcaggtg
gaccggcgggcggtgctgacggccgccctctccggcgcctccgcgcccgtactcctcgcc
ccgtccaccacggacatcgaggtcgcccaggagtggttcgagcggtacgagggcgcgggg
ctcgacgggatcgtggccaagccgctggatctgccgtaccggcccgacacccgggtgatg
tacaagatcaagcacgagcggaccgccgacgtcgtggtggcggggtaccgggagcacaag
agcggcccggtcgtcggctcgctcctgctcggcctgtacgacaccgggggcgtgctccag
cacgtcggggtctgcgcggccttccccatgaggcggcgcgccgagctggccgaggaactc
gccccgctgcggtgcgagttcgccgaccacccgtggggggcgtgggcggacgcggcggcg
cacgaggcctcccggctgccggggacgcagaaccgctggtccggcaagaaggaccagtcg
tgggtgccgctgcggccggagcgggtctgcgaggtggcgtacgaccacatggagggcgac
cggttccgccatacgacacagttccggcggtggcgcccggaccgggacccggccggctgc
acgtacgcgcagctggaggaggtcgtctcctacgacctggccgaggtgctgtcggggggc
ggctga

DBGET integrated database retrieval system