KEGG   Streptomyces fulvissimus: SFUL_6958Help
Entry
SFUL_6958         CDS       T02650                                 

Definition
(RefSeq) DNA polymerase LigD, ligase domain protein
Organism
sfi  Streptomyces fulvissimus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7831878..7832231
Genome map
AA seq 117 aa AA seqDB search
MRTEGILVGGWLPGHGRLTSLPGALLVGLPGPDGRLRYVGAVGTGWSDTERTTLAALLDT
VASDTCPFTERPAVAGARWVVPRLVGEVRYATRTEAGRLRHPSWHRLRPDLAPDGVS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaccgagggcatcctcgtcggcggctggctgcccggccacggccgcctcacctct
ctgcccggcgccctcctcgtgggcctgcctggccccgacggacggctccgctacgtcggg
gccgtcggtaccggctggagcgacaccgaacgcaccaccctcgccgccctcctcgacacc
gttgcatccgacacctgcccgttcaccgaacggcccgcagtggccggagcccggtgggtg
gtgccccgcctggtcggagaggtccgctacgcgacccgcaccgaagccggacgcctgcgc
cacccctcctggcaccgcctgcgccccgacctcgcccccgacggcgtcagctga

DBGET integrated database retrieval system