KEGG   Streptomyces fulvissimus: SFUL_6958Help
Entry
SFUL_6958         CDS       T02650                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
Organism
sfi  Streptomyces fulvissimus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AGK81835
UniProt: N0D1A9
Position
7831878..7832231
Genome map
AA seq 117 aa AA seqDB search
MRTEGILVGGWLPGHGRLTSLPGALLVGLPGPDGRLRYVGAVGTGWSDTERTTLAALLDT
VASDTCPFTERPAVAGARWVVPRLVGEVRYATRTEAGRLRHPSWHRLRPDLAPDGVS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaccgagggcatcctcgtcggcggctggctgcccggccacggccgcctcacctct
ctgcccggcgccctcctcgtgggcctgcctggccccgacggacggctccgctacgtcggg
gccgtcggtaccggctggagcgacaccgaacgcaccaccctcgccgccctcctcgacacc
gttgcatccgacacctgcccgttcaccgaacggcccgcagtggccggagcccggtgggtg
gtgccccgcctggtcggagaggtccgctacgcgacccgcaccgaagccggacgcctgcgc
cacccctcctggcaccgcctgcgccccgacctcgcccccgacggcgtcagctga

DBGET integrated database retrieval system