KEGG   Shigella flexneri 301 (serotype 2a): SF0230Help
Entry
SF0230            CDS       T00097                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SF0230 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SF0230 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SF0230 (phoA)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SF0230 (phoA)
Exosome [BR:sfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SF0230 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(253195..254679)
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTDVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPL
LGLFADGNMPVRWLGPKATYHGNIDKPAVTYTPNPQRNDSVPTLAQMTDKAIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQ
VVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggat
tcggaaattactgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaactggcaaa
ccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccgatgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgctgcgctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaacgctcgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggca
accgctggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtgaacgatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctg
cttggcctgtttgctgacggcaatatgccagtgcgctggctagggccgaaagcaacgtac
cacggcaatatcgataagcccgcagtcacctatacgcctaatccgcaacgtaatgacagt
gtaccaaccctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaa
ggatttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaaccct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gctaaaaaggagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccag
gttgttgcgccggataccaaagcgccgggcctcactcaggcgctaaatactaaagatggc
gcagtgatggtgatgagttacgggaattccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccag
accgatctcttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system